Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "laws"

1. Congress, is responsible for making laws

2. Representatives participate in legislative processes, proposing and voting on laws and policies.

3. Scientific inquiry is essential to our understanding of the natural world and the laws that govern it.

4. Supreme Court, is responsible for interpreting laws

5. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

6. The executive branch, represented by the President of the United States, is responsible for enforcing laws

7. The Supreme Court is the highest court in the land and has the power of judicial review, meaning it can declare laws unconstitutional

8. Traffic laws are designed to ensure the safety of drivers, passengers, and pedestrians.

Random Sentences

1. He applied for a credit card to build his credit history.

2. Pull yourself together and stop making excuses for your behavior.

3. Naglaro sa palaruan ang mga bata nang limahan.

4. Nakalimutan kong magdala ng flashlight kaya nahirapan akong makita sa pagdidilim ng gubat.

5. Ipinakita ng pamilya ni Maria ang kanilang pagtanggap sa pamamamanhikan ng pamilya ni Juan.

6. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

7. Sa sulok ng kanyang kaliwang mata'y nasulyapan niya ang ina.

8. Matagal na napako ang kanyang tingin kay Kano, ang sumunod sa kanya.

9. Nagsisilbi siya bilang doktor upang mapangalagaan ang kalusugan ng kanyang pasyente.

10. Nangahas ang manunulat na talakayin ang kontrobersyal na isyu sa kanyang aklat.

11. Honesty is the best policy.

12. Pneumonia can be prevented with vaccines and by maintaining good hygiene.

13. She attended a series of seminars on leadership and management.

14. Håbet om at opnå noget kan motivere os til at tage skridt for at nå vores mål.

15. Arbejdsgivere tilbyder ofte sociale fordele som sygesikring og betalt ferie.

16. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

17. Work-life balance is important for maintaining overall health and wellbeing.

18. Nakapila ako sa bayad center upang magbayad ng kuryente.

19. Some people argue that it's better not to know about certain things, since ignorance is bliss.

20. Ikinakagalit ko ang mga sakim na minahan.

21. La música es una forma de expresión que puede ser utilizada para conectarnos con otros y compartir nuestras emociones.

22. Ano ho ang gusto ninyong orderin?

23. A mi esposa le encanta hacer manualidades como pasatiempo.

24. Laughter is the best medicine.

25. Marahil ay hindi niya naaalala ang pangalan mo kaya't dapat mo siyang i-pakilala.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Fødslen kan føre til hormonelle og følelsesmæssige ændringer, så det er vigtigt at tage sig af sin mentale sundhed.

28. May kakaibang naramdaman ang prinsesa sa makisig na binata na iyon.

29. Nakatayo ang aking guro sa harapan ng silid-aralan upang ipakita ang kanyang mga visual aids.

30. Electric cars are available in a variety of models and price ranges to suit different budgets and needs.

31. Ha? Anong konek ng gas sa taong nagugutom?

32. Las heridas en áreas articulares o que afectan nervios o vasos sanguíneos pueden requerir de intervención quirúrgica para su reparación.

33. Limitations can be financial, such as a lack of resources to pursue education or travel.

34. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

35. Natatanaw na niya ngayon ang gripo.

36. Magkano ang polo na binili ni Andy?

37. Medyo kakaiba ang pusang ito sapagkat makapal ang kulay dalandan na balahibo.

38. Sin agua, los seres vivos no podrían sobrevivir.

39.

40. Les chatbots d'intelligence artificielle peuvent aider les entreprises à répondre aux demandes des clients.

41. Tu peux me passer le sel, s'il te plaît?

42. Ang Tagaytay ay itinuturing na "Little baguio dahil sa lamig ng klima dito".

43. Der er mange forskellige former for motion, herunder aerob træning, styrketræning og fleksibilitetstræning.

44. Ang mga bata ay natutong maging responsable sa pamamagitan ng pagsasagawa ng gawaing nagiigib ng tubig sa halamanan.

45. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

46. Healthcare providers and hospitals are continually working to improve the hospitalization experience for patients, including enhancing communication, reducing wait times, and increasing patient comfort and satisfaction.

47. Siya ay madalas mag tampo.

48. Can you please stop beating around the bush and just tell me what you really mean?

49. Cryptocurrency wallets are used to store and manage digital assets.

50. Las plantas son seres vivos que realizan la fotosíntesis para obtener energía.

Recent Searches

lawslenguajeangkanumaagostsakaexhaustedprutasmartesmagulangpumatolmalihisdennemakahingihetogodtjenasoundpuwedemanghulikinantavetoutilizarmahirapsamang-paladbabamovingnaroonferrerbehalfumilingjuniomonetizingjoyputiareagrabelibreresponsibleageatamatandaoftedonlastingnakagawiansportsnakakatulongnagngangalangnakapagngangalitpinagsikapannagbabakasyonpotaenagratificante,gayunpamanimikmadulasfarmgayasumusunodpamamasyalmagsusunurankinabubuhayobserverernagkakasyapagkakamalipagkaimpaktosasayawinkapatawaranpaki-translatemakikipaglaropinakamatabangnagtatamponakatuwaangmanlalakbaymakauuwibangladeshnag-iisipnakatuonnangapatdanskirtnakilalagumuhitnagbentamagkanolondonmasyadongmagtakananunuksonanalonakalocktinataluntonpagkaraamagpapigiltotoongyumaonapapahintonagwagiyakapinmakukulaydiwatai-rechargepalancanagtakaibinilinakapasamedicinepaglisanpagmamanehorebolusyonnakaraansinasadyapinuntahannakaririmarimnagkapilatnangyaribumangonshoppingkambingfreedomsmagtanimpanataglabahinasahanboyfriendlugawrimastsinapagpalitvitaminitinaasnatitirangnaawaisinarapinaulananbakatiemposgagamitpanginoonbefolkningenawitanpasahesementonglibertyalagangmatagumpayiligtasmangingisdangnawalaiiwasanapelyidorodonabinge-watchingnabuhaylever,limitedpinatirahagdanlihimtugonathenaambagkargangcarbonbisikletamanilagreatlyenglandisinumpayoutubeanongmonumentotsinelasawardsawapagodlegislationlaryngitishusokwebanasabingbiglachildrenwaripangitbigotepisomakaratingtradeoperahantumangosentencetseskypecapacidadugatmisazoomtenderhamakboyet