Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "godt"

1. Det er vigtigt at have et godt støttenetværk, når man bliver kvinde.

2. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

3. Landet er et godt eksempel på, hvordan man kan skabe en velfungerende

Random Sentences

1. May nadama siyang ginhawa ngunit pansamantala lamang iyon.

2. Naku, ang taas pala ng temparatura ko.

3. El agua tiene propiedades únicas, como la capacidad de disolver sustancias y regular la temperatura.

4. Mahalaga ang papel ng edukasyon sa pagpapalawig ng kaalaman at oportunidad para sa sektor ng anak-pawis.

5. Taon-taon ako pumupunta sa Pilipinas.

6. Los padres pueden elegir compartir el momento del nacimiento con familiares y amigos cercanos, o mantenerlo privado y personal.

7. Many wives have to juggle multiple responsibilities, including work, childcare, and household chores.

8. The United States has a system of federalism, where power is divided between the national government and the individual states

9. Si John ay isang mabuting kaibigan, datapwat minsan ay napag-uusapan namin ang mga hindi magandang bagay.

10. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

11. Min erfaring inden for dette område har været meget givende.

12. Nasa akin pa rin ang huling halakhak.

13. Sino-sino ang mga kakuwentuhan mo sa klase?

14. Tumango ako, you want? alok ko sa kanya.

15. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

16. Her decision to sponsor a child’s education was seen as a charitable act.

17. Kelahiran di Indonesia biasanya dianggap sebagai momen yang sangat penting dan bahagia.

18. Naglakad ang mga sundalo sa kalsada nang limahan.

19. Pupunta ako sa Madrid sa tag-araw.

20. Maglalaro ako ng tennis. Ikaw?

21. Adopting a pet from a shelter can provide a loving home for an animal in need.

22. Danmark eksporterer også en betydelig mængde medicinske produkter.

23. Napadungaw siya sa kanyang cellphone at napansin na mayroon siyang mga hindi pa nabasang mensahe.

24. Ang mga firefighter nagsisilbi upang protektahan ang mga tao mula sa mga sunog.

25. Despite the many advancements in television technology, there are also concerns about the effects of television on society

26. Está claro que necesitamos más tiempo para completar el proyecto.

27. Pumunta daw po kayo sa guidance office sabi ng aking teacher.

28. The vertical axis of an oscilloscope represents voltage, while the horizontal axis represents time.

29. Babyens første skrig efter fødslen er en betydningsfuld og livgivende begivenhed.

30. Christmas is an annual holiday celebrated on December 25th to commemorate the birth of Jesus Christ.

31. Anong oras nagbabasa si Katie?

32. Omelettes are a popular choice for those following a low-carb or high-protein diet.

33. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

34. Humigit-kumulang sa tatlong daan taong namalagi sa Pilipinas ang mga Kastila.

35. Det er vigtigt at kende sine grænser og søge hjælp, hvis man oplever problemer med gambling.

36. Nagtataka ako kung bakit ganito ang mga nangyayari sa mundo ngayon.

37. Ang mais ay tumutubo nang mabuti sa lugar na may malaking access sa araw at sapat na kahalumigmigan

38. Ano namang inasikaso mo sa probinsya?

39. Les patients peuvent être transférés dans des unités de soins spécialisées en fonction de leur état de santé.

40. Sumali ako sa Filipino Students Association.

41. Sa mula't mula pa'y itinuring na siya nitong kaaway.

42. Ikaw ang bumitaw! hila-agawan ang ginagawa namin.

43. Sa aming pagtitipon, nagkaroon ng palaro at paligsahan na nagpapakita ng diwa ng bayanihan.

44. Ano ang gustong orderin ni Maria?

45. Some people enjoy adding cream, sugar, or other flavorings to their coffee to enhance its taste.

46. Mathematical formulas and equations are used to express relationships and patterns.

47. Oh sige na nga sabi mo eh. hehe.

48. Natawa ang bata ngunit pumayag din ito.

49. Ang pagiging maramot sa kaalaman ay nagiging hadlang sa tagumpay ng iba.

50. Hindi ako nakatulog sa eroplano.

Recent Searches

nanunuksogodtdividespagpasensyahanschedule11pmconditionsimplengdesarrollarsobraattacklibagtapejunjunilingclockumabotuntimelyincreasesmakakibotumunogisubomagdilimminutoisipmagpaniwalawordkotsengngunitkumakalansingnakinigkalabawbaranggaygeologi,minamahalkinauupuangcnicoadvancesaddictionpoottalemahiraptrainspaanoihahatidika-12netflixbundokumisipnuevosonidobukodbesidesnapakabutinaiiniscuentancultivarpagtatanimsakin1000magkasakitnagsamasamfundkumampianitolumiwagipipilitsiguradoenterdiwatasumunodpagtataposbalikatestudiopagkakapagsalitabiyernesnangangaralnakangisinge-booksgumigisingendviderenaglulutoindustriyabibisitamaratingdyanbayanuwaknanghahapdiparatinggawingnagbabalareduceddumaramimitigatenapatulalagngpinangaralankinalimutancontinuedconstitutionkayarabbacassandramapag-asangpaglulutootrasheartbreakipagbilinatanongparehonglastlumiwanagsilbingpilipinastalinoleytesugatdrewnapapahintoadventwhilebitbitstringmakawalafuncionarasignaturakulisaptumangoleftcountlesskalayaanproductionlawspalasyohumigaumiimikpakakasalantsismosaregulering,formasfuronline,compartennicohimayintiyakategori,commercialnapakamisteryosopresidentialgratificante,eskwelahankaloobangfotoscomemaghahandapulongmaliitrevolucionadobilaotumawagnegosyobagalundeniablefredricomaulittagtuyotlaryngitissapilitanglansanganlatercareernapakamaaricommunicationstumatakbomustmayokanayonnaramdamannagtatakbochambersnagbibigayanpaanahantadpasswordmaibabalikdebatesinfinitypaki-translatekinamumuhianmagbagong-anyonapakahusaypulamanilapangungutyatomardone