Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

65 sentences found for "its"

1. "A dog wags its tail with its heart."

2. "Every dog has its day."

3. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

4. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

5. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

6. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

7. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

8. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

9. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

10. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

11. Don't underestimate someone because of their background - you can't judge a book by its cover.

12. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

13. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

14. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

15. Football is known for its intense rivalries and passionate fan culture.

16. From its early days as a technology for the elite, to its current status as a staple in most

17. Fundamental analysis involves analyzing a company's financial statements and operations to determine its value.

18. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

19. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

20. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

21. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

22. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

23. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

24. Just because someone looks young, it doesn't mean they're not experienced - you can't judge a book by its cover.

25. Known for its sunny weather, Los Angeles enjoys a Mediterranean climate throughout the year.

26. Lazada has a strong focus on customer service and has won awards for its efforts.

27. Lazada has expanded its business into the logistics and payments sectors, with Lazada Express and Lazada Wallet.

28. Lazada has faced criticism over counterfeit products being sold on its platform.

29. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

30. Los Angeles is famous for its beautiful beaches, including Venice Beach and Santa Monica Beach.

31. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

32. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

33. Reinforcement learning is a type of AI algorithm that learns through trial and error and receives feedback based on its actions.

34. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

35. Some people enjoy adding cream, sugar, or other flavorings to their coffee to enhance its taste.

36. Television has a rich history, and its impact on society is far-reaching and complex

37. Tesla has expanded its operations globally, with presence in various countries and plans for further expansion.

38. Tesla has faced challenges and controversies, including production delays, quality control issues, and controversies surrounding its CEO, Elon Musk.

39. Tesla is known for its innovative electric car models, including the Model S, Model 3, Model X, and Model Y.

40. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

41. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

42. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

43. The company burned bridges with its customers by providing poor service and low-quality products.

44. The company used the acquired assets to upgrade its technology.

45. The company's acquisition of new assets will help it expand its global presence.

46. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

47. The Cybertruck, an upcoming electric pickup truck by Tesla, has garnered significant attention for its futuristic design and capabilities.

48. The fashion designer showcased a series of collections, each with its own unique theme and style.

49. The French omelette is a classic version known for its smooth and silky texture.

50. The laptop's hefty price tag reflected its powerful specifications and high-end features.

51. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

52. The patient's quality of life was affected by the physical and emotional toll of leukemia and its treatment.

53. The power of a single act of kindness can be immeasurable in its impact.

54. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

55. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

56. The telephone has undergone many changes and improvements since its invention

57. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

58. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

59. The United States is known for its entertainment industry, including Hollywood movies and Broadway shows.

60. The website's analytics show that the majority of its users are located in North America.

61. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

62. TikTok has faced controversy over its data privacy policies and potential security risks.

63. Twitter is known for its role in breaking news and providing a platform for public discussions and debates.

64. Wala kang pakelam! O sige its my turn na!

65. You can't judge a book by its cover.

Random Sentences

1. Nag-aaral ang estudyante sa laybrari.

2. Tanghali na nang siya ay umuwi.

3. El tamaño y el peso del powerbank pueden variar según la capacidad de la batería.

4. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

5. Ultimately, Christmas is a time of unity and togetherness, bringing people of all backgrounds and beliefs together to celebrate the spirit of love and hope.

6. Microscopes have played a critical role in the development of modern medicine and scientific research.

7. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

8. Dahil sa biglaang pagkawala ng kuryente, hindi ako makapagtrabaho kanina.

9.

10. Nahulog ang bola sa dagat kaya lumangoy si Rico para kunin ito.

11. Las escuelas tienen diferentes especializaciones, como arte, música, deportes y ciencias.

12. La anaconda verde es una de las serpientes más grandes del mundo y es conocida por su capacidad para aplastar a sus presas.

13.

14. The king's coronation is a ceremonial event that officially marks his ascension to the throne.

15. Ang payat at namumutla ang dalaga kaya nag-alala ang binata.

16. Hun blev nødt til at skynde sig, fordi hun havde glemt sin pung på kontoret. (She had to hurry because she had forgotten her wallet at the office.)

17. Awang-awa ang maraming katutubo sa pagpapasan sa krus si Padre Novelles.

18. Tulala lang rin yung daddy niya sa amin.

19. Mahirap makita ang liwanag sa gitna ng mailap na kadiliman.

20. Los padres experimentan un profundo vínculo emocional con su bebé desde el momento del nacimiento.

21. Magkita tayo sa parking lot ng Luneta Park.

22. Before a performance, actors often say "break a leg" to each other for good luck.

23. Ang resiliency ng mga Pinoy ay patunay ng kanilang lakas sa harap ng pagsubok.

24. Ang aking kabiyak ay palaging nasa tabi ko sa hirap at ginhawa.

25. Nagtagisan ng galing ang mga maghahabi.

26. Foreclosed properties may have back taxes or other outstanding debts, which the buyer may be responsible for paying.

27. Bumuga siya ng hangin saka tumingin saken.

28. Sana ay masilip.

29. El ciclo del agua es un proceso natural que involucra evaporación, condensación y precipitación.

30. May mga espesyal na pagdiriwang tuwing Linggo sa aming komunidad malapit sa karagatan.

31. Mabuti pa roon, kahit nakabilad sa init.

32. The wedding rehearsal is a practice run for the wedding ceremony and reception.

33. Bilang paglilinaw, ang pagsasanay ay para sa lahat ng empleyado, hindi lang sa bagong hire.

34. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

35. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

36. Yumabong ang pagkakaisa ng mga tao sa panahon ng krisis.

37. Si Tony ang pinakabatang bilanggo sa bilibid na may angking talino

38. Dahil ika-50 anibersaryo nila.

39. Bawal magpakalat ng basura sa kalsada dahil ito ay maaaring makasira sa kalikasan.

40. Fui a la fiesta de cumpleaños de mi amigo y me divertí mucho.

41.

42. Ang kanyang determinasyon ay nagliliyab habang nilalabanan ang mga pagsubok sa buhay.

43. Bis bald! - See you soon!

44. The dedication of mentors and role models can positively influence and shape the lives of others.

45. Siya ay maramot sa pagbibigay ng tulong kahit marami siyang pera.

46. El arte es una forma de expresión humana.

47. El paisaje que rodea la playa es sublime, con sus aguas cristalinas y suave arena.

48. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

49. Marahil ay mas mahal ang presyo ng gulay ngayon kumpara sa nakaraang buwan.

50. Mukha namang pangkaraniwan lang ang matanda at baka nga hindi pa nito alam kung paano humabi.

Similar Words

itsuratitserlitsonhitsurahabitstransmitsbenefits

Recent Searches

itshulingclaseskurakotmakapangyarihangmongnakatagotatawaganmarahaslottechniquesundaspinasalamatanemailrepresentativefeelingchunsilakatieriquezanasisiyahaninvestelepanteusemaranasanpinagmasdanourumuwimariellinggonatutulogkumembut-kembotmagulanglahateasiertanyaglumilipadbundokbuwan300pingganag-emailideyacreatividadnagpakitaedukasyonayanpangakohitsuraano-anopagtutoldispositivoblendeducativasnahuhumalingkaniyanapilimanilbihanibapitongtahananayusinnakatulongngunitpartiessupilinnakaupoikinakatwirannakangitiiwasanespanyoltaranabahalabinigaypaskosustayomalapadbakitplasaenterhiningisellingkuwentodahilbituinnakikitangmahinanglihimbackcharmingninumannagturonabuointerestsenergypintoestéformapilipinosalapiapollobungadmanyroughkapangyarihangenvironmentkinapanayaminutusankesoloobutak-biyanaisdumukotmapakaliexpertlatenakuhaeffectswaliskaalamanItsuraitinaaskayapostcardditokasaganaanmatapobrengnag-away-awayhigitmag-asawanghimutokbunsoshortinsidentemukhangkulunganpinangalanangmasayang-masayapinamalagiitokaagadcashmasayangcafeteriacarboncuriouspulangtumitigilmaliituposuriinpamilyahayopganangyatatamadiilanexecutiveumupoikinakagalitrambutankapitbahaytinangkangpinagtatalunansincetrippintuanalinspecialkaysarapvitaminsapagkatmag-ibaaraw-arawnabigaypinagtabuyancongratshadlangitimtakesprobablementepongparkingbastaprobinsiyakumunotprobinsyapagbabagong-anyolossitaymagpalagocallerlalakadtarangkahan,ganunbodegakampanatulalalabanan