Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

65 sentences found for "its"

1. "A dog wags its tail with its heart."

2. "Every dog has its day."

3. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

4. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

5. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

6. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

7. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

8. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

9. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

10. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

11. Don't underestimate someone because of their background - you can't judge a book by its cover.

12. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

13. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

14. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

15. Football is known for its intense rivalries and passionate fan culture.

16. From its early days as a technology for the elite, to its current status as a staple in most

17. Fundamental analysis involves analyzing a company's financial statements and operations to determine its value.

18. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

19. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

20. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

21. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

22. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

23. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

24. Just because someone looks young, it doesn't mean they're not experienced - you can't judge a book by its cover.

25. Known for its sunny weather, Los Angeles enjoys a Mediterranean climate throughout the year.

26. Lazada has a strong focus on customer service and has won awards for its efforts.

27. Lazada has expanded its business into the logistics and payments sectors, with Lazada Express and Lazada Wallet.

28. Lazada has faced criticism over counterfeit products being sold on its platform.

29. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

30. Los Angeles is famous for its beautiful beaches, including Venice Beach and Santa Monica Beach.

31. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

32. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

33. Reinforcement learning is a type of AI algorithm that learns through trial and error and receives feedback based on its actions.

34. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

35. Some people enjoy adding cream, sugar, or other flavorings to their coffee to enhance its taste.

36. Television has a rich history, and its impact on society is far-reaching and complex

37. Tesla has expanded its operations globally, with presence in various countries and plans for further expansion.

38. Tesla has faced challenges and controversies, including production delays, quality control issues, and controversies surrounding its CEO, Elon Musk.

39. Tesla is known for its innovative electric car models, including the Model S, Model 3, Model X, and Model Y.

40. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

41. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

42. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

43. The company burned bridges with its customers by providing poor service and low-quality products.

44. The company used the acquired assets to upgrade its technology.

45. The company's acquisition of new assets will help it expand its global presence.

46. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

47. The Cybertruck, an upcoming electric pickup truck by Tesla, has garnered significant attention for its futuristic design and capabilities.

48. The fashion designer showcased a series of collections, each with its own unique theme and style.

49. The French omelette is a classic version known for its smooth and silky texture.

50. The laptop's hefty price tag reflected its powerful specifications and high-end features.

51. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

52. The patient's quality of life was affected by the physical and emotional toll of leukemia and its treatment.

53. The power of a single act of kindness can be immeasurable in its impact.

54. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

55. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

56. The telephone has undergone many changes and improvements since its invention

57. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

58. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

59. The United States is known for its entertainment industry, including Hollywood movies and Broadway shows.

60. The website's analytics show that the majority of its users are located in North America.

61. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

62. TikTok has faced controversy over its data privacy policies and potential security risks.

63. Twitter is known for its role in breaking news and providing a platform for public discussions and debates.

64. Wala kang pakelam! O sige its my turn na!

65. You can't judge a book by its cover.

Random Sentences

1. Hindi dapat tayo magbulag-bulagan sa mga insidente ng abuso sa ating paligid.

2. Haha! Bad mood na bad mood ka ah?

3. Napakamot na lang ng ulo si Kenji.

4. She has completed her PhD.

5. He admires the athleticism of professional athletes.

6. They are not singing a song.

7. Napuno ako ng poot nang malaman ko ang mga kasinungalingan na ibinato sa akin.

8. Kung sino ang maagap, siya ang magandang kinabukasan.

9. You reap what you sow.

10. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

11. She has a poor credit history due to late payments and defaults on loans.

12. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

13. Min erfaring har lært mig, at tålmodighed er en dyd.

14. Walang tutulong sa iyo kundi ang iyong pamilya.

15. Morning.. sabi niya na halos parang ang hina niya.

16. He has bought a new car.

17. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

18. The symptoms of pneumonia include cough, fever, and shortness of breath.

19. Nagtatrabaho ako sa Youth Center.

20. My best friend and I share the same birthday.

21. Das Gewissen kann uns helfen, moralische und ethische Fragen zu beantworten.

22. Dedication to environmental conservation involves taking actions to protect and preserve our planet for future generations.

23. Sumagot agad si Kuya isang ring pa lang.

24. Las redes sociales pueden ser una fuente de entretenimiento y diversión.

25. The momentum of the train caused it to derail when it hit a curve too quickly.

26. My boyfriend took me out to dinner for my birthday.

27. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

28. At ignorere sin samvittighed kan føre til skyldfølelse og fortrydelse.

29. My friends surprised me with a birthday cake at midnight.

30. Sa droga, walang nagwawagi kundi ang tao mismo.

31. Nakakapagpatibay ng buto ang calcium.

32. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

33. Mahalaga na hindi tayo mawalan ng pag-asa sa ating mga pangarap.

34. Inisip ko na lang na hindi sila worth it para hindi ako mag-inis.

35. Iyon pala ay isang diyosa na nagpapanggap lamang.

36. Matapos ang mahabang panahon ng paghihintay, ang aking pag-aabang ay napawi nang dumating ang inaasam kong pagkakataon.

37. Ahh Mommy, anong oras ba yung flight mo? tanong ni Maico.

38. Araw-araw na bumalik ang prinsesa sa kagubatan hanggang ang bulaklak ay napalitang ng bunga.

39. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

40. Sa kabila ng pag-usbong ng modernong medisina, nananatili pa rin ang tiwala ng marami sa albularyo.

41. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

42. Sila ay nagpapakita ng dedikasyon sa paglilingkod sa kapwa at sa bayan.

43. In the early days, telephones were connected to a central switchboard, which connected calls manually

44. Sa aming eskwelahan, ang mga mag-aaral ay nagtatanim ng mga gulay sa school garden.

45. Einstein was a critic of quantum mechanics, famously declaring that "God does not play dice with the universe."

46. Yan ang totoo.

47. Samang-palad, tamad ang binatilyong apo, ayaw tumulong sa lola at, araw-araw, bumababa sa baranggay upang makipag-barkada at magsugal.

48. I know things are difficult right now, but hang in there - it will get better.

49. Kasama ho ba ang koryente at tubig?

50. Batman, a skilled detective and martial artist, fights crime in Gotham City.

Similar Words

itsuratitserlitsonhitsurahabitstransmitsbenefits

Recent Searches

itspakpaknakabaonisinulatnaturalarbularyoborncharismaticimagesearlypaghaharutanexigentebook:cosechar,kalabanproductionhumahangosuulaminbasketgoodpesobiliskailanganemphasistrajesumusunokubonailigtasasalmalimitromeronamenangampanyawidenakakapagpatibaymagtigilcreativeairconkendiimportanteantibioticstienesilbingnapaiyaknakaraandanceseriousdemocracysong-writingtherapeuticsroomaniyaunabeingbinulongpaosaddpalengkemakikikainpaidnatandaannaposinisiraeducationinirapannilayuanunaneventosneainstrumentalpumapaligidviolenceanak-mahiraphayaanhoynamumutlahunipopulardikyamarturogivehadpapasalalapagdiriwangmag-asawanginantokpetrhythmnakakatandananinirahanphilosophicalbalancesnakakagalingbumitawcasesgodfredresumenimpitrisemumuntingpagkaangattherelivespooreranghelkabarkadacanteenalagangsumalakayanthonyenglishe-commerce,sumiboldistansyapalapagmaghapongdaramdamincaraballofarbinasapamagatlimosjustchoicecontent,pagtiisanfaceinabutanbarohverrevolucionadotrasciendetheirsinkbilibidriskmanuksomaluwangkomedornangingilidaeroplanes-allsmokinggamitinvivakalaromaghilamosbinibilireferssondecisionsdarktodayjoketumakbocomemagpahabalalabhansikopitakanapakonanunurilivetripmagsasalitamaaringsusithingsgowntrafficcommunicationbeenkagandatuktokkinainnageespadahanvednagagandahansueloahhhhcareerpatayalwaysmagkapatidmakulongkargahanpinamalagiencuestasendingkinalilibingannakakasamadetectedworkingprinceothers,longclarafulfillmentmagtaka