Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

65 sentences found for "its"

1. "A dog wags its tail with its heart."

2. "Every dog has its day."

3. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

4. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

5. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

6. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

7. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

8. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

9. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

10. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

11. Don't underestimate someone because of their background - you can't judge a book by its cover.

12. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

13. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

14. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

15. Football is known for its intense rivalries and passionate fan culture.

16. From its early days as a technology for the elite, to its current status as a staple in most

17. Fundamental analysis involves analyzing a company's financial statements and operations to determine its value.

18. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

19. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

20. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

21. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

22. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

23. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

24. Just because someone looks young, it doesn't mean they're not experienced - you can't judge a book by its cover.

25. Known for its sunny weather, Los Angeles enjoys a Mediterranean climate throughout the year.

26. Lazada has a strong focus on customer service and has won awards for its efforts.

27. Lazada has expanded its business into the logistics and payments sectors, with Lazada Express and Lazada Wallet.

28. Lazada has faced criticism over counterfeit products being sold on its platform.

29. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

30. Los Angeles is famous for its beautiful beaches, including Venice Beach and Santa Monica Beach.

31. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

32. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

33. Reinforcement learning is a type of AI algorithm that learns through trial and error and receives feedback based on its actions.

34. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

35. Some people enjoy adding cream, sugar, or other flavorings to their coffee to enhance its taste.

36. Television has a rich history, and its impact on society is far-reaching and complex

37. Tesla has expanded its operations globally, with presence in various countries and plans for further expansion.

38. Tesla has faced challenges and controversies, including production delays, quality control issues, and controversies surrounding its CEO, Elon Musk.

39. Tesla is known for its innovative electric car models, including the Model S, Model 3, Model X, and Model Y.

40. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

41. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

42. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

43. The company burned bridges with its customers by providing poor service and low-quality products.

44. The company used the acquired assets to upgrade its technology.

45. The company's acquisition of new assets will help it expand its global presence.

46. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

47. The Cybertruck, an upcoming electric pickup truck by Tesla, has garnered significant attention for its futuristic design and capabilities.

48. The fashion designer showcased a series of collections, each with its own unique theme and style.

49. The French omelette is a classic version known for its smooth and silky texture.

50. The laptop's hefty price tag reflected its powerful specifications and high-end features.

51. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

52. The patient's quality of life was affected by the physical and emotional toll of leukemia and its treatment.

53. The power of a single act of kindness can be immeasurable in its impact.

54. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

55. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

56. The telephone has undergone many changes and improvements since its invention

57. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

58. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

59. The United States is known for its entertainment industry, including Hollywood movies and Broadway shows.

60. The website's analytics show that the majority of its users are located in North America.

61. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

62. TikTok has faced controversy over its data privacy policies and potential security risks.

63. Twitter is known for its role in breaking news and providing a platform for public discussions and debates.

64. Wala kang pakelam! O sige its my turn na!

65. You can't judge a book by its cover.

Random Sentences

1. Hun har en figur, der er svær at ignorere. (She has a figure that's hard to ignore.)

2. Naging bahagi ang mga kanta ng Bukas Palad sa aking proseso ng pagsasanay sa pagtugtog ng gitara.

3. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

4. La moda de usar ropa estrafalaria está llamando la atención de los jóvenes.

5. May lagnat, sipon at ubo si Maria.

6. Ang kanyang galit ay nagbabaga sa ilalim ng malamig niyang mga ngiti.

7. El agua es un tema de importancia mundial y está relacionado con el desarrollo sostenible y la seguridad alimentaria.

8. Les hôpitaux peuvent être des endroits stressants pour les patients et leur famille.

9. El teatro experimental presenta una interpretación sublime del teatro moderno.

10. Hinugot niya ang kanyang bag sa ilalim ng mesa.

11. The Jungle Book introduces Mowgli, a young boy raised by wolves, as he encounters various jungle animals and learns life lessons.

12. When we read books, we have to use our intelligence and imagination.

13. Football is known for its intense rivalries and passionate fan culture.

14. Halos dalawang linggong nag quarantine ang pamilya ni Josie matapos mag positibo sa covid.

15. To break the ice with a shy child, I might offer them a compliment or ask them about their favorite hobbies.

16. Uh huh? medyo naguguluhan kong sabi.

17. Einstein was a vocal critic of Nazi Germany and fled to the United States in 1933.

18. Einstein was a pacifist and advocated for world peace, speaking out against nuclear weapons and war.

19. Hay muchos géneros de música, como el rock, el pop, el jazz y el clásico.

20. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

21. He is running in the park.

22. Marmaing sandaling walang nangahas magsalita.

23. En mi tiempo libre, aprendo idiomas como pasatiempo y me encanta explorar nuevas culturas.

24. Ang aming mga pangarap at layunin ay pinagsasama namin bilang magkabilang kabiyak.

25. Pull yourself together and let's figure out a solution to this problem.

26. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

27. Making large purchases without consulting your budget is a risky move.

28. They play video games on weekends.

29. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

30. A penny saved is a penny earned

31. Tuwang tuwa siya sa mga palaka, para sa kanya ay nakakaakit ang mga malalaki at bilugang mata ng mga ito.

32. Sa harap ng outpost ay huminto ang pulis.

33. Oscilloscopes can be connected to a computer or network for data logging, remote control, and analysis.

34. Butterfly, baby, well you got it all

35. Malapit lang pala bahay niyo eh. akala ko naman malayo!

36. Ang pagbabayad ng utang ay magpapakita ng pagiging responsable sa pagpapalago ng financial status.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Ang bagal ng sistema ng pagbabayad ng buwis.

39. Ang mga firefighter nagsisilbi upang protektahan ang mga tao mula sa mga sunog.

40. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

41. Hindi niya iningatan ang kanyang cellphone, samakatuwid, nasira ito agad.

42. Omelettes are a popular choice for those following a low-carb or high-protein diet.

43. Ang saya saya niya ngayon, diba?

44. Bilang paglilinaw, ang pagsusulit ay hindi bukas kundi sa susunod na linggo.

45. Pabili ho ng isang kilong baboy.

46. Tila wala siyang naririnig.

47. Das Gewissen kann uns helfen, die Auswirkungen unserer Handlungen auf die Welt um uns herum zu verstehen.

48. Hinawakan ko na lang yung pisngi niya. Matulog na tayo.

49. Ailments can be diagnosed through medical tests and evaluations, such as blood tests or imaging scans.

50. Foreclosed properties can be a good option for those who are looking for a fixer-upper project.

Similar Words

itsuratitserlitsonhitsurahabitstransmitsbenefits

Recent Searches

itsdumukotmightbatangimpornownanlilisikpahiramnapaghatianmagbibiyaheshadesmatuklapmaruruminapaplastikanaksidenterubberkagubatanadvertising,alexanderumuuwilasinggerofaktorer,makakuhanawalanbanalpaghangatumikimbio-gas-developingdelenitongmagsasalitanaguguluhangpagkapunoalongmaaaringpamangkinnagpabakunamauliniganmatangtumubopressmagkikitadistanceadaptabilitykamalayanangkopmainitbaboytipcoalsundhedspleje,habangdaraandrawingpakilutogivebiyahelilimcompositoresanak-pawismulpaalamhapasinpinagmamalakipinagsasabiwaysinterestsmobilitydapit-haponchristmasnakahugnegosyantenauwinaglahorobinhoodanilapuntahanbrasogrownamulatfindephilosopherlunesaccuracykumpletokalannakapagusapkatagangililibrenagpabottumangocultivatednakakapasokistasyoninisppasensyasagabalpaliparinmaskarajaysontapatpandalawahankuwartakagustuhangnapadamipagdukwanghealthnagrereklamolaronangahascruzapoilawnakabibingingunti-untingbawalsarililockdownleftretirarsalitangklasenggumuhitstrategiesopochildrenmaawaingkabangisanpagraranasdoktoraddsaan-saanagricultoresmaghahabiumiibigbutchnaylagnatteamskillsnapatawagpaki-translateculturesinilabasmataraykatibayangnami-missjoeramonbinawisakimhalikannilaostinakasanoperateinspirenagwagigumantinatatangingmadamitanganmisusedideamagselosinnovationwasakconvey,haponpoorerkonekpermitentinaposwaaagumalingcompartenpinagtatalunanrecordedmulafreeandrespleasesampaguitapasiyentepatongmagkitakumantamabiromawalapansinjustaktibistapinagpalaluankahitkungnaglalakadaplicanagdadasalteacherlegendsiglap