Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "asul"

1. Ang kulay asul na saranggola ay sumayaw sa bughaw na langit.

2. Asul ang kulay ng mata ng anak ko.

3. Bilang paglilinaw, ang damit na dapat isuot ay kulay puti, hindi asul.

4. Kaninong payong ang asul na payong?

5. Sino ang nakasuot ng asul na polo?

Random Sentences

1. Sa tuwa ng bata ay napasigaw ito at tinawag ang mga kapitbahay upang matikman din nila ang prutas.

2. Nilinis ng mga taga-Tungaw ang kanilang maruming ilog.

3. Los powerbanks también pueden tener características adicionales, como indicadores LED que muestran el nivel de carga.

4. Agad na ginamot ni Mang Sanas si Nam at nawala ang lahat ng kaniyang mga sakit at sugat.

5. Bakit sila nandito tanong ko sa sarili ko.

6. Pagdating namin dun eh walang tao.

7. Scissors can be sharpened using a sharpening stone or taken to a professional for sharpening.

8. La science des données est de plus en plus importante pour l'analyse et la compréhension de grandes quantités d'informations.

9. Madalas na may agam-agam sa buhay ng mga estudyante tuwing magkakaroon ng exam o project submission.

10. Grande's dedication to her artistry and philanthropy continues to inspire fans worldwide.

11. Hun blev nødt til at skynde sig, fordi hun havde glemt sin pung på kontoret. (She had to hurry because she had forgotten her wallet at the office.)

12. Naglalaro ang walong bata sa kalye.

13. Eine hohe Inflation kann das Wirtschaftswachstum verlangsamen oder stoppen.

14. Bakit ba gusto mo akong maging bestfriend?!

15. Saan pupunta si Larry sa Linggo?

16. La Navidad y el Año Nuevo se celebran en invierno.

17. Nakarating ako ng 4th floor at ako pa rin ang pinag uusapan.

18. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

19. Ilang gabi pa nga lang.

20. Las redes sociales tienen un impacto en la cultura y la sociedad en general.

21. Ese vestido rojo te está llamando la atención.

22. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

23. Frustration is a feeling of disappointment, annoyance, or anger that arises when we are unable to achieve a desired outcome.

24. Sa palaruan, maraming bata ang nag-aagawan sa isang bola.

25. The TikTok algorithm uses artificial intelligence to suggest videos to users based on their interests and behavior.

26. Kung hindi ka interesado, okay lang, pero sana pwede ba kita ligawan?

27. Some viruses, such as herpes and HIV, can remain in the body for life and cause chronic infections.

28. El cilantro es una hierba muy aromática que se utiliza en platos de la cocina mexicana.

29. Ang aking kaibuturan ay nababagabag sa mga pangyayari sa mundo ngayon.

30. Ang malalakas na hiyaw ng galit at pagkadismaya ay binulabog ang kapayapaan ng pagtitipon.

31. A wife's love and devotion can provide a stable foundation for a long-lasting marriage.

32. Kelahiran di Indonesia biasanya dianggap sebagai momen yang sangat penting dan bahagia.

33. Grover Cleveland, the twenty-second and twenty-fourth president of the United States, served from 1885 to 1889 and from 1893 to 1897, and was known for his economic policies and opposition to corruption.

34. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

35. Malamang na tamaan ka pa ng kidlat.

36. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

37. Ngunit naglahong parang bula si Pinang.

38. Hindi maaring magkaruon ng kapayapaan kung ang marahas na kaguluhan ay patuloy na magaganap.

39. Los Angeles, California, is the largest city on the West Coast of the United States.

40. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

41. Umalis siya kamakalawa ng umaga.

42. Women's relationships with their bodies have been shaped by societal expectations and cultural norms.

43. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

44. Ang poot ay maaaring maging mapaminsalang puwersa kapag hindi ito naayos nang maayos.

45. Hun er utrolig smuk. (She is incredibly beautiful.)

46. Miss, nakalabas na ba yung pasiyente dito?

47. Tengo muchos sueños y aspiraciones. (I have many dreams and aspirations.)

48. Maingay ang bagong taon sa Pilipinas.

49. El agua es un tema de importancia mundial y está relacionado con el desarrollo sostenible y la seguridad alimentaria.

50. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

Similar Words

nasulyapannakakasulat

Recent Searches

asuldiwatapagbebentabutihinginfinitypagkalungkothalamanmulingvaccinesikinabitcomputerekalalarokapitbahaytuvomababawinvesting:harililigawankaniyapumasokbinatakdenboyetjosekapangyarihangtalentedmag-uusapelementaryniyanalagutanpapuntakuripotestablishnakapasacomputere,magturotssspagtiisanagosmainitkalikasanmatandang-matandamakaindesisyonantsonggotelebisyongeologi,atinpulonghalamangnabahalalumipatbaranggayunosparangnagpalalimredyamanoktubrerepublicanpinagsulatgayunpamanlumabasnakumbinsikasinggodnagliliyabfutureagaw-buhaymalezakayapakikipagbabagkinikilalanggayunmanenglishpamilyapagpapakalatmalumbaylargerlibrepinakamatapatparticipatingnathanbagamateksempelfindiyakkalakiiskedyulrelonalalamanresultmabutibilhantumawagsisterconsidereddumaannerissatinanggapmallyaripakilutomakapangyarihangputiestudyantenapatayobangladeshipinabalotmakikipagsayawsabadonghumahangahanapinvictorialatemayabangdyipnimissionmagalang1982nagsagawaeducationbumabahamedya-agwatsinanakapuntabinitiwanmagworkrelievedsumindihverlungsodemailpagpapasanagam-agampag-uwibadspeedclassroomwhyrosemagka-aponunona-fundnariyanlaranganhimignag-oorasyontulisansusulitallesakimmagpagupitnakasahodkinabukasankinabubuhaybalitakapefilmsnaglokobulaklakhumihingimagkaibangitinuloslintaabonovivalimatikyelonakakalasingsumagotspecificcreatingreservationkawalanunderholdertermcanadakarangalanpagsayadahitfitnagsisigawsumingitvocalnapilialimentopanatilihinpasyanyesagasaansunud-sunodpaparusahanbihasaindianogensindetenganakatagopigainnaulinigan