Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "juegos"

1. El internet es una fuente de entretenimiento, como videos, juegos y música.

2. Estos dispositivos ejecutan sistemas operativos como Android o iOS y pueden descargar y ejecutar aplicaciones de diferentes categorías, como juegos, redes sociales, herramientas de productividad, entre otras

3. Los juegos de mesa son un pasatiempo divertido para jugar en familia o con amigos.

Random Sentences

1. Ano ang gustong sukatin ni Elena?

2. Bumili si Pedro ng bagong bola para sa kanilang basketball game.

3. She has learned to play the guitar.

4. Palagi niyang suot ang kanyang korona upang ipakita na siya ay makapangyarihan.

5. Panay pa ang post nito sa facebook ng bagong damit eh hiram lang naman nya ang lahat nang yun.

6. Ang bilis nya natapos maligo.

7. Dedication is the commitment and perseverance towards achieving a goal or purpose.

8. Si Pedro ang tatay ko at siya ang nanay ko.

9. La película produjo una gran taquilla gracias a su reparto estelar.

10. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

11. Si John ay isang mabuting kaibigan, datapwat minsan ay napag-uusapan namin ang mga hindi magandang bagay.

12. Mahalagang mag-ingat sa ating kalusugan, datapapwat ay hindi natin nakikita ang mga mikrobyo at virus na nagdadala ng sakit.

13. The traffic signal turned green, but the car in front of me didn't move.

14. Siya ang aking kaulayaw sa lahat ng bagay.

15. He was hospitalized for pneumonia and was on a ventilator for several days.

16. En invierno, el cielo puede verse más claro y brillante debido a la menor cantidad de polvo y humedad en el aire.

17. Ibinigay niya ang bulaklak sa nanay.

18. Scissors can be stored in a scissor case or stand to keep them organized and easily accessible.

19. Supporting policies that promote environmental protection can help create a more sustainable future.

20. Kapag nasa agaw-buhay na sitwasyon, kailangan nating mag-ingat at magtulungan para sa ating kaligtasan.

21. Dahil kung anong ganda ng katawan ay siya namang pagkaimpakto ng mukha.

22. Namiss kita eh. Sabay ngiti ko sa kanya.

23. Madalas banggitin si Carlos Yulo sa mga balita tuwing may malaking kompetisyon.

24. Naglalaway ang mga tao sa pila habang nag-aabang sa paboritong fast food chain.

25. Les jeux peuvent avoir des règles et des limitations pour protéger les joueurs et prévenir la fraude.

26. Trump's foreign policy approach included renegotiating international agreements, such as the North American Free Trade Agreement (NAFTA) and the Paris Agreement on climate change.

27. Kumaripas ang delivery rider para maihatid ang order sa takdang oras.

28. Ibinigay ko na ang lahat ng makakaya ko upang matulungan ka.

29. Salud por eso.

30. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

31. I am exercising at the gym.

32. Dapat magkaroon ng patas na pagtrato sa lahat ng sektor ng lipunan, kabilang ang anak-pawis.

33. Saan pumunta si Trina sa Abril?

34. Ano bang pinagsasasabi mo jan Kuya?

35. La rotación de cultivos es una práctica agrícola que ayuda a mantener la salud del suelo.

36. Itinapon nina Fred at Melvin ang basura

37. The stock market can be influenced by global events and news that impact multiple sectors and industries.

38. Chester A. Arthur, the twenty-first president of the United States, served from 1881 to 1885 and signed the Pendleton Civil Service Reform Act.

39. May mga kuwento sa baryo na ang albularyo ay minsang nagpagaling ng isang taong naparalisa.

40. From its early days as a technology for the elite, to its current status as a staple in most

41. Every year, I have a big party for my birthday.

42. ¡Claro que sí, acepto tu invitación!

43. He does not break traffic rules.

44. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

45. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

46. Maaaring magdulot ng agam-agam ang mga suliraning pang-ekonomiya tulad ng kahirapan at pagtaas ng presyo ng mga bilihin.

47. Mange små og mellemstore virksomheder i Danmark eksporterer varer og tjenester.

48. How I wonder what you are.

49. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

50. Kapag mayroong mga proyektong mahirap, pinagsisikapan ng mga manggagawa na matapos ito ng maayos.

Recent Searches

kuryentejuegosmahinalinggongsasapakinmasungitkumantanamilipitnaglulusaktomorrowpnilitsisipainhacerpatongbalotganitotamisgagambagigisingbalitaanumangpangnangmagnagwo-workhdtvsuprememagisingfulfillingnagdarasalmahahabaattentionpetsangsnanagbasaverybroughtipanlinismalapadterminocellphonefriemawalabagohuliriskabenelimatikfeelpaypicskagayacleanpinunitshapingmaramibawanatitiramalambotoffentligfallastateechaveniyankasuutanvarietycelularesroboticself-publishing,mabaitpagsisisicalidadmagsalitakailanmanmakauwilumakidahonlalomatagpuanourhigh-definitionmostbetweentillmayabangnapakamisteryosoquarantinegownbuwenaskagalakancallingprovemulibiologipalancapinakidalanakauwiandresadecuadonataposbalatmakaratingguardainintayforståsystemmatapobrengpusamarangyangmaliwanaginterpretingplatformssumalinaritosutilvirksomhederstocksmanamis-namistinahakmalambingmatabangsay,nagbibigayanprincipaleslabishinalungkatgrocerysparkspendingpasaheropagkababamagbubungaamazonpitoreceptormaismakahingimasaganangbayadnakatirangsallybutopalitanpronounnaiyaktumatawaggumandapagdiriwangrememberedcitecoathundrednogensindeumaliskatagalaniyakmakingydelserkumukuhakubyertoskinikilalangnaglalaronagandahannagpupuntamasamaworkingreservestemperaturamiyerkulesbarhanapbuhaymanirahanvideosbumalikestadossunud-sunodmakisuyopabiliaywanmanonoodduwendekundimanmetodiskpaglayaspromotingsedentaryslavesagingdumatingitimnaglipanangnapatawagpinakamagalingtotoongpagsahodtagaytaysagasaanmaisusuotmahahawagawaincombatirlas,