Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "should"

1. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

2. Diving into unknown waters is a risky activity that should be avoided.

3. Fraud and scams related to money are a common problem, and consumers should be aware of potential risks and take steps to protect themselves.

4. He also believed that martial arts should be used for self-defense and not for violence or aggression

5. Healthy eating should include a variety of proteins, carbohydrates, and healthy fats.

6. I know I should have apologized sooner, but better late than never, right?

7. I know I should have gone to the dentist sooner, but better late than never.

8. I know I should have started studying earlier, but better late than never, right?

9. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

10. It's important to remember that April Fool's jokes should always be in good fun - nobody likes a prank that's mean or hurtful.

11. La esperanza es un regalo que debemos valorar y compartir con los demás. (Hope is a gift that we should cherish and share with others.)

12. Scissors should be handled with care to avoid injuries and kept out of reach of children.

13. Scissors should be kept sharp to ensure clean and precise cuts.

14. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

15. Stress can be a contributing factor to high blood pressure and should be managed effectively.

16. Therefore, we should all steer clear of this bad habit of smoking cigarettes

17. There?s a world out there that we should see

18. We should have painted the house last year, but better late than never.

Random Sentences

1. Successful entrepreneurs attribute their achievements to hard work, passion, and unwavering dedication.

2. Napakabuti nyang kaibigan.

3. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

4. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

5. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

6. Botong boto sa kanya ang mga magulang ng kanyang kasintahan.

7. Dahil matamis ang dilaw na mangga.

8. How I wonder what you are.

9. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

10. I absolutely love spending time with my family.

11. There are a lot of reasons why I love living in this city.

12. Los teléfonos móviles, también conocidos como celulares, son probablemente los tipos de teléfonos más comunes en la actualidad

13. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

14. Kan du skynde dig lidt? Vi skal nå bussen. (Can you hurry up a bit? We need to catch the bus.)

15. El discurso del líder produjo un gran entusiasmo entre sus seguidores.

16. Ang paglapastangan sa mga propesyonal at kanilang propesyon ay isang paglapastangan sa kanilang dedikasyon at pagsisikap.

17. Mababa ang marka niya sa pagsusulit dahil hindi siya nakapag-aral.

18. Bago lumaban sa kompetisyon, sinisigurado niyang isagawa ang kanyang ritwal ng pagmumuni-muni upang mapanatag ang sarili.

19. Sa panahon ng kahirapan, mahalaga ang mga kaulayaw na handang magbigay ng suporta.

20. Ang paglapastangan sa mga indibidwal at kanilang karapatan ay hindi dapat maging bahagi ng isang lipunan na may respeto.

21. Sa harapan niya piniling magdaan.

22. Ayaw niya ng maarte at mataas na presyo kaya lagi siyang nagbabakasakali sa mga mababang halaga.

23. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

24. Eh bakit mo binili para sa kanya yun kung ganun?

25. Bigla nya akong binato ng unan, H-hoy! Magtigil ka nga!

26. También cuentan con pantallas táctiles y una gran cantidad de memoria interna para almacenar información, fotos, videos y música

27. In 1905, Einstein published a series of papers that established the foundations of modern physics and earned him worldwide recognition.

28. El amor todo lo puede.

29. Nag-aaral siya sa Osaka University.

30. Bakasyon ko na sa susunod na buwan.

31. Gracias por ser una inspiración para mí.

32. Malilimutin si Marco kaya’t laging paalala ang sinasabi ng kanyang ina.

33. Ang sugal ay nagdudulot ng pagkawala ng kontrol at pagkakaroon ng mga labis na panganib.

34. Sa matinding takot ay nagsunuran ang mga mangingisda sa di nila nakikilalang matanda.

35. Mahalagang ipaglaban natin ang ating kalayaan sa pamamagitan ng tamang pamamaraan.

36. The study of viruses is known as virology, and scientists continue to make new discoveries about these complex organisms.

37. Hindi sila masiyado nakapagusap dahil nagpaalam agad ang dalaga na kailangan na niyang matulog.

38. I am enjoying the beautiful weather.

39. Ang tag-ulan ay kadalasang panahon ng pagtatanim ng mga halaman at tanim dahil sa malakas na pag-ulan.

40. Ang pagkakaroon ng sapat na tulog ay nakakatulong sa pagpapanatili ng tamang timbang.

41. Ligaya ang pangalan ng nanay ko.

42. Magkano ho ang arkila ng bisikleta?

43. Hindi ko kinuha ang inyong pitaka.

44. Ilan ang tao sa silid-aralan?

45. I caught my boyfriend staring at a picture of a pretty lady on his phone.

46. Skærtorsdag mindes Jesu sidste nadver med sine disciple, før han blev taget til fange.

47. Masakit para sa isang ina ang sinapit ng kanyang anak ngunit masaya sa kaloobang tinanggap iyon ni Busyang.

48. Sweetness can also be found in natural sweeteners, such as honey and maple syrup.

49. Isang araw nagkasakit si Aling Rosa.

50. Kailangan nating magsumikap upang makamit ang ating mga pangarap.

Recent Searches

juegosshouldpumatolsementonumberkinginalalalahatkatamtamanmapilitangalfredlumiwagdistanceshalamannapohinahanapsagaballintafireworkssayawanharap-harapangbinawiantumatawabringcommercialyumabongmaulitangkanbakantenamatayinterestharapannapapadaansakanakasimangotmag-anakbroadwondernitoipinadakipantesmulti-billiongathernagsamainiindapalangitimakauwimandukotanimodeliciosabalikattangkamahawaansasambulatnakapikitcryptocurrencyibabailagayassociationmagwawalanasabihuhthroughunangskillsmagagalingnagbentanakapamintanabulaklaknag-uumirimaanghangnabalotmakakainmanakbodrewagaditinaponkilalalaruininitpinansinsponsorships,inangaspirationminahanmuntinlupamaniladigitalkapangyahirantigrelumagobilerginoonagkakakainbasahanmwuaaahhrevolutionizedlumampasnakabuklatmagnakawmag-plantcandidateschickenpoxkinayaemphasisimprovepakelamsegundosunud-sunodnakaratinge-explainarmaelpowerpointprogressflashtarcilasusnakituloghardtungkolsulingannaritonagkakamalilaganappilipinasbinibilangpatiencetienenakatayodumapakolehiyomatabangmagpalibrehuertokesokanluranricamoviesde-dekorasyonmrstaingainamarchtoolsthinglokohinflyasiaticnagkakasyahumingahumblepagkalipassakyanothersmauliniganmangyayaricupidmamarilhulupagtuturoinformationmatatalomagawanakabanggaaffiliatebastagumigitisocialenangangalirangnakayukonakatalungkorambutanindeninakalangumamponkare-karetaga-hiroshimaiginitgitmapagkatiwalaanpag-akyatnagsipagtagooutkumanannagalittrainingtatawagpaskotsinaiconicplantarparangulitpinauwihitatinangkangcorporationbutasikinuwentonagtuloykaganda