Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "should"

1. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

2. Diving into unknown waters is a risky activity that should be avoided.

3. Fraud and scams related to money are a common problem, and consumers should be aware of potential risks and take steps to protect themselves.

4. He also believed that martial arts should be used for self-defense and not for violence or aggression

5. Healthy eating should include a variety of proteins, carbohydrates, and healthy fats.

6. I know I should have apologized sooner, but better late than never, right?

7. I know I should have gone to the dentist sooner, but better late than never.

8. I know I should have started studying earlier, but better late than never, right?

9. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

10. It's important to remember that April Fool's jokes should always be in good fun - nobody likes a prank that's mean or hurtful.

11. La esperanza es un regalo que debemos valorar y compartir con los demás. (Hope is a gift that we should cherish and share with others.)

12. Scissors should be handled with care to avoid injuries and kept out of reach of children.

13. Scissors should be kept sharp to ensure clean and precise cuts.

14. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

15. Stress can be a contributing factor to high blood pressure and should be managed effectively.

16. Therefore, we should all steer clear of this bad habit of smoking cigarettes

17. There?s a world out there that we should see

18. We should have painted the house last year, but better late than never.

Random Sentences

1. The heavy traffic on the highway delayed my trip by an hour.

2. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

3. Den danske kirke fejrer påsken med flere forskellige ceremonier i løbet af Holy Week.

4. Limitations can be frustrating and may cause feelings of disappointment and failure.

5. Sop buntut adalah sup yang terbuat dari ekor sapi dengan rempah-rempah dan sayuran yang kaya rasa.

6. Les personnes âgées peuvent être bénéfiques pour la société en partageant leur expérience et leur sagesse.

7. Women have the ability to bear children and have historically been associated with nurturing and caregiving roles.

8. Natutunan ko ang mga awiting Bukas Palad mula sa aking mga magulang na parehong Katoliko.

9. Mas matangkad ako kaysa sa kanya.

10. Ang editor ay nagsusulat ng mga komento at mga pagsusuri sa mga akda ng mga manunulat.

11. Bagai pinang dibelah dua.

12. Huwag kang lalayo nang palayo sa amin para hindi ka mawala.

13. Huwag ring magpapigil sa pangamba

14. Ah miss, tanong lang... Iyo bang lahat yan?

15. No pierdas la paciencia.

16. ¿Te gusta el sabor picante del jengibre?

17. Umokay ang result ng pagsusulit ni Jayson matapos itong magsunog ng kilay.

18. Pangarap ko ang makasakay sa eroplano.

19. Menciptakan keseimbangan antara pekerjaan, waktu luang, dan hubungan sosial membantu meningkatkan kebahagiaan.

20. Investing in the stock market can be risky if you don’t do your research.

21. Ang Ibong Adarna ay nakapagbigay ng inspirasyon sa maraming manunulat at makata upang magsulat ng kanilang sariling mga obra.

22. Ano ba pinagsasabi mo?

23. Tumayo tayo para awitin ang Pambansang Awit.

24. Fødslen kan føre til forskellige fysiske forandringer i kroppen, og genopretningstiden varierer fra person til person.

25. La música es una forma de arte universal que se ha practicado en todas las culturas desde tiempos ancestrales

26. Eine Inflation kann auch die Investitionen in Forschung und Entwicklung beeinflussen.

27. The candidate who wins the most electoral votes becomes the President

28. Bwisit ka sa buhay ko.

29. Pasensya na pero kailangan ko nang umalis.

30. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

31. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

32. During the holidays, the family focused on charitable acts, like giving gifts to orphanages.

33. Nagbabaga ang pakiramdam ng kanyang balat dahil sa matagal na pagkabilad sa araw.

34. Hinintay ko siya sa labas ng kanyang opisina upang sabay kaming kumain ng hapunan dahil gustong-gusto ko siyang ligawan.

35. Nahihilo ako dahil masyadong maalog ang van.

36. One of the most significant areas of technological advancement in recent years has been in the field of communications

37. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

38. Palibhasa ay mahilig mag-aral at magpahusay sa kanyang mga kakayahan.

39. Nakapag-celebrate kami ng aming anniversary ng asawa ko kaya masayang-masaya ako ngayon.

40. Anong lugar ang pinangyarihan ng insidente?

41. Sino ang kinukuha ng mga sundalo?

42.

43. Ang buhangin sa tabing-dagat ay nagbabaga sa init ng araw kaya’t mahirap itong apakan.

44.

45. Black Panther is the king of Wakanda and possesses enhanced strength, agility, and a suit made of vibranium.

46. Ayan sasamahan ka na daw ni Kenji.

47. Habang naglalakad, naisip niya na maganda ang ideya na lumibot sa paligid ng kanyang silid-aralan para makahanap ng inspirasyon.

48. Las plantas pueden entrar en un estado de dormancia durante el invierno, reduciendo su crecimiento.

49. Hindi nawawala ang halaga ng panitikan sa pagpapalaganap ng kultura at kaalaman, kaya't ito ay mahalaga sa buhay ng mga tao.

50. Det er vigtigt at have en kompetent og erfaren jordemoder eller læge til stede under fødslen.

Recent Searches

shouldmakasarilingjosemagpa-picturelarangansciencekidlatmeetperlaouelingidlimangleukemiacryptocurrency:spentelectronicbisigdidingimpactitinuringataquesshockhariactingfeedback,informednilapitannapakalusogchangenagreklamobilibnawawalainfluencewaringumilingnakataasidolbahagyangtuwangsilid-aralaninomsocietypongpromisecarloschoolsrevolucionadokasamaandiagnoseslimosdietmanggapalaisipancandidatemauupoarbejdsstyrkenamataymartialalbularyokoryentecompositoresbesesnapakabilismagbabalanapilingpressnilulonevenpangambaparusahangoshelvismatalikpicskilayhehemasipagcasayeloanumanhouseholdsmirapinagkiskisunfortunatelynatayotransitattentionkahilingantradisyoncanadawikasarilitalephonesapagkatarbejdermay-arihinintayguestskamaynakakatawaisinulatbawatdurantebaduybinigyangbrancher,estarbuhoktuyongtigilkastilangbroadcastingmagsugaltulangbaronglagunapatiflyinfluentialreducedstarpumulotleyteparangalintuntunindiyanarghblusapeepmodernebumangonkainopisinakinalimutangivepinilitnabitawanpetsangkamalayanhulihannagkantahanlumakinghinipan-hipankommunikererbanlaglot,masukolamericanatitirangsasapakinmisyunerongmagkikitarabbasheipinamilicommunicateteknolohiyagagambagigisingherramientasasthmahuwebeskutsilyoperwisyobusyfuryareasmagkahawaktubig-ulankasawiang-paladbaku-bakongginoongpamilyamangkukulamtinakasanmakatatlobroadcastsasukalmalimitsumalithankejecutanmaratingbangbeginningagamaglinisgawainlargerhapag-kainanrelevantpersonalmagalitpinuntahannamulaklakpagkakapagsalitanabubuhaynanalonanunuri