Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "should"

1. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

2. Diving into unknown waters is a risky activity that should be avoided.

3. Fraud and scams related to money are a common problem, and consumers should be aware of potential risks and take steps to protect themselves.

4. He also believed that martial arts should be used for self-defense and not for violence or aggression

5. Healthy eating should include a variety of proteins, carbohydrates, and healthy fats.

6. I know I should have apologized sooner, but better late than never, right?

7. I know I should have gone to the dentist sooner, but better late than never.

8. I know I should have started studying earlier, but better late than never, right?

9. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

10. It's important to remember that April Fool's jokes should always be in good fun - nobody likes a prank that's mean or hurtful.

11. La esperanza es un regalo que debemos valorar y compartir con los demás. (Hope is a gift that we should cherish and share with others.)

12. Scissors should be handled with care to avoid injuries and kept out of reach of children.

13. Scissors should be kept sharp to ensure clean and precise cuts.

14. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

15. Stress can be a contributing factor to high blood pressure and should be managed effectively.

16. Therefore, we should all steer clear of this bad habit of smoking cigarettes

17. There?s a world out there that we should see

18. We should have painted the house last year, but better late than never.

Random Sentences

1. Paano ho pumunta sa Manila Hotel?

2. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

3.

4. Hindi pa rin siya lumilingon.

5. Elektronisk udstyr kan hjælpe med at optimere produktionsprocesser og reducere omkostninger.

6. Madalas akong nakakarinig ng kakaibang ingay sa labas ng bahay sa hatinggabi.

7. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

8. Maraming misteryo ang bumabalot sa kanilang lugar.

9. I complimented the pretty lady on her dress and she smiled at me.

10. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

11. Nahawakan ko ang katawan ko, Umabot ba kami hanggang dun?

12. Natanong mo na ba siya kung handa na siya?

13. Ang aso ni Lito ay mataba.

14.

15. Ang sugal ay maaaring magdulot ng pagkawala ng pag-aasenso at pagkakataon sa buhay.

16. Limitations can be physical, mental, emotional, financial, or social.

17. Amazon started as an online bookstore, but it has since expanded into other areas.

18. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

19. I caught my boyfriend staring at a picture of a pretty lady on his phone.

20. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga mapanganib na mikrobyo sa mga kalsada at iba pang mga lugar.

21. If you're expecting a quick solution to a complex problem, you're barking up the wrong tree.

22. Some people invest in cryptocurrency as a speculative asset.

23. Dogs are often referred to as "man's best friend".

24. "A dog is the only thing that can mend a crack in your broken heart."

25. Aku rindu padamu. - I miss you.

26. Bagay na bagay sayo ang suot mong damit.

27. Sino yung naghatid sayo? biglang tanong niya.

28. Sapagkat misyunero, marami ang naliwanagan sa katotohanan.

29. Tradisyon na nang mga Pilipino ang pagsisimbang gabi.

30. Verified accounts on Twitter have a blue checkmark, indicating that they belong to public figures, celebrities, or notable organizations.

31. Lahat ng magagaling na maghahabi ay napakahanga sa kakayanan ni Amba.

32. Tumawag ako kaninang umaga pero wala ka.

33. Es importante estar atento a las plagas y enfermedades, y utilizar métodos orgánicos para controlarlas

34. Gumagawa ng tinapay si Tito Mark sa kusina.

35. Bagama't nawalan ng kapangyarihan ay naging maligaya naman ito sa piling ni Ramon at ng kanilang mga anak.

36. Maarte siya sa mga hotel na tinutuluyan kaya hindi siya nakikipagtipon sa mga backpacker's inn.

37.

38. Nakakain ka ba ng mga pagkaing Pilipino?

39. Eine klare Gewissensentscheidung kann uns ein gutes Gefühl geben und unser Selbstbewusstsein stärken.

40. Le stress peut avoir des effets néfastes sur la santé mentale et physique.

41. I-google mo na lang ang mga tanong na hindi mo maintindihan.

42. Ang pagmamahal at pag-aalaga ng aking kabiyak ay nagbibigay sa akin ng kasiyahan at kaligayahan.

43. Si Rizal ay isang maalam na mag-aaral na nag-aral sa Unibersidad ng Santo Tomas, Unibersidad ng Madrid, at Unibersidad ng Heidelberg.

44. Nagpunta kami sa peryahan kagabi.

45. Maingay ang bagong taon sa Pilipinas.

46. Ang pagtulog ay mahalaga para sa kalusugan at kagalingan ng isang tao.

47. Ayoko pong nakakulong sa madilim na lugar na kinalalagyan ko.

48. Noong 2019, nanalo si Carlos Yulo ng gintong medalya sa World Artistic Gymnastics Championships.

49. Uncertainty about the outcome of the election has caused tension in the community.

50. Sa Sabado ng hapon ang pulong.

Recent Searches

duloworkingshouldlearnroondrewvirksomheder,jobtiyakforcesniyanprovidedpyschesunud-sunurannanghihinainabothumanganidpag-iwanlungsodhenrymagsuotsampaguitakotsengpinisilsahodkaniyangmartianpinagkiskiswerekaharianinvolveguidemensahebabaeromulayanagwadornapakagagandawinsmagta-taxiandygospelmikaelaamericasubalitcarsnananaginiptinatawagpagkakayakapmarketplacesmumuranakatuwaangnapakatalinomaglalakadkaaya-ayangpinapakiramdamanhumalakhakflysisternageenglishkinatatakutanmanamis-namisnagkitapodcasts,gobernadorkayang-kayangtabing-dagatsiniyasatdadalawinmensajeskarunungannakatirangmagpaliwanaghitsurapinahalatatatawagannapaluhakikitanagtatanongina-absorvemagkamalicourtmakuhangdiretsahangyoutube,tiktok,nawawalapupuntahannanlakipagtawatungawmagkapatidadgangmangahaspaghahabimagkasabaylalabhanmananaloistasyonunattendedkatuwaanmananakawmakikitulogkesonaiinisisusuotmakapalhinihintaypinauwikangitankapintasangtinataluntonmagkasakitpuntahannapatigildancetsismosabinabarattraditionalsakalingfreedomsmaskinertusonglolaguerrerokarapatangnagbibigayantinanggalaccedersalamangkeracoughingnovembercandidatescampaignshunibumagsakvelfungerendesidomahigpitbibilipulgadarenaiasinungalingsellingsilasocialpulitikoprosesoaguabagokabarkadarepublicanmagsaingmisteryotawaalmacenarwasteninongmabaitjenacapacidadmagandangkumbentosapatlalakeamericanmatesakutodsandalipalakapabalangaudiencekagandaponginterestsblusamanuksoconsumemalaki1954talentpasigawlegacygearanimoybecomeespigas1000mayrooniilanbiglanumerosasdulotfurgraphicisangkarapataneeeehhhhprobablemente