Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "father"

1. A father is a male parent in a family.

2. A father's love and affection can have a significant impact on a child's emotional development and well-being.

3. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

4. A successful father-child relationship often requires communication, patience, and understanding.

5. Ang kumbento ang madalas tambayan ni Father at Sister.

6. Humayo kayo at magpakarami! ayon ang biro ni Father Ramon.

7. James Madison, the fourth president of the United States, served from 1809 to 1817 and was known as the "Father of the Constitution."

8. Nasa kumbento si Father Oscar.

9. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

10. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

Random Sentences

1. Hulyo ang kaarawan ng nanay ko.

2. Ang mailap na kaharian ay kailangan paghirapan upang mapasakamay.

3. Los héroes son personas que enfrentan grandes desafíos y se levantan para superarlos.

4. Sumigaw ng malakas si Perla "Paro! Paro!", marami ang nakarinig at tinulungan siya ngunit walang Amparo silang nakita.

5. Les personnes âgées peuvent être victimes d'abus ou de négligence de la part de leur entourage.

6. Namnamin natin ang bawat sandali ng bakasyon.

7. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

8. He has been hiking in the mountains for two days.

9. Nagre-review sila para sa eksam.

10. Sebagai bagian dari perayaan kelahiran, orang Indonesia sering mengadakan acara syukuran atau kenduri.

11. They organized a marathon, with all proceeds going to charitable causes.

12. Ihamabing o kaya ihalintulad ang isang bagay sa ibang bagay

13. Mathematics can be used to optimize processes and improve efficiency.

14. Amazon has a reputation for being innovative and forward-thinking.

15. Libre si Clara sa Sabado ng hapon.

16. Saan ka kumuha ng ipinamili mo niyan, Nanay?

17. Julia Roberts is an Academy Award-winning actress known for her roles in films like "Pretty Woman" and "Erin Brockovich."

18. Medarbejdere kan arbejde på en sæsonmæssig basis, som landmænd.

19. Algunas personas se dedican a crear arte como su profesión.

20. I hate it when people beat around the bush instead of just getting to the point.

21. Sa gitna ng kalsada, ang nagdudumaling kotse ay maingat na dumadaan sa intersection.

22. Hindi pa rin makapagsalita si Mang Kandoy.

23. Sa takipsilim naglalakad ang matanda sa tabing-dagat.

24. She wakes up early every morning to exercise because she believes the early bird gets the worm.

25. Kumaliwa ka papuntang Masaya Street.

26. Isang araw sa kanyang pamamasyal ay may nakilala siyang isang bagong mukha.

27. Ang pakikinig sa mahinahong agos ng ilog ay nagbibigay sa akin ng isang matiwasay na pakiramdam ng kalma at katahimikan.

28. Kaya't tama lamang na ito rin ay kanyang ipapamana sa nag-iisang anak.

29. Pumunta sila sa albularyo upang magpagamot ng kanyang pananakit ng likod.

30. Sang-ayon ako na ang edukasyon ay isang mahalagang pundasyon sa pag-unlad ng isang bansa.

31. John Adams, the second president of the United States, served from 1797 to 1801.

32. El internet ha hecho posible la creación y distribución de contenido en línea, como películas, música y libros.

33. The art class teaches a variety of techniques, from drawing to painting.

34. Once upon a time, in a faraway land, there was a brave little girl named Red Riding Hood.

35. Sa probinsya, ang mga bukirin ay sumasalamin sa mayabong na kabuhayan ng mga magsasaka.

36. Oy bawal PDA dito! natatawang sabi ni Lana.

37. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

38. Salamat po at pinagbigyan nyo ako.

39. Sa pag-alis niya sa tahanan, nag-iwan siya ng mga alaala at mga kuwentong puno ng pagmamahal.

40. Si Bereti ay mula sa angkan na may maalwang buhay.

41. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

42. The surface of the football field can vary, but it is typically made of grass or artificial turf.

43. Gracias por darme la oportunidad de aprender y crecer.

44. We have cleaned the house.

45. Many people go to Boracay in the summer.

46. Nagbabakasyon ako tuwing Abril.

47. Kangina pa ako nakapila rito, a.

48. Thumbelina is a tiny girl who embarks on a journey to find true love and her place in the world.

49. Sa kaibuturan ng kanyang puso, alam niya ang tama at mali.

50. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

Recent Searches

kulotwifiiniintayfatherbandadeterminasyonsapotmaalwangsellingnocheanghelbuwayamunanghardinparangipinansasahoghojastinanggapmakasarilingletteribonbotantehalamanantumangofarmutilizarmatapangrevolutionizedipantalopbokideasconvertidasisugakatabingatentounderholdernatanggapkerbencompassespinatidwaysukatdrewgenerationertransparentpalagingmapakalidamitstevelegislativekumaripasreservednathanbarrierssusunduinbackuminomnasundosafedivideschecksresourcessagingeducationalpracticadostandbroaddonaletopic,aniprogramsaddingcomputersamesourcegitaraevolveformatmapformsitlogfroginteligentescompletenananaloculturamakikiligoumuulanpulubitaglagasngunitalsokabiyakayudagubatbarangaymauntogcardiganmartianarturonagwikangpatakbongomfattendemananahianylabinsiyammarurumikaringpinapasayadipanglaryngitisbalinganlumiwanagpasigawunidosnaglalambingpopularinstrumentalamuyinjejustatepaskorolledkasalananlakadtradisyonworrybulongalagaumulanschoolnararapatmanakboseparationjolibeepawisprobinsyabataynasuklamfencingtutungobangnewspapersdaysbroadcastingnagngangalangmabutinginstitucionesnahintakutanmagtigiltanggalinnagnakawnapaiyaknagbanggaancrossincidencefionayoutube,fe-facebookbilipaglingonsolidifywalisninapublishedkonggovernorsindividualshockinfluencedi-kawasapopcorntelefonrequirebangladeshumangattibigencounteranotherlilipadinventiontabibring10thdiferentesnagcurveiyontresisubotumapospagbibirolinamagbibiyahesementomagbayadrevolucionadomakikipag-duetotemparaturasenador