Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "father"

1. A father is a male parent in a family.

2. A father's love and affection can have a significant impact on a child's emotional development and well-being.

3. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

4. A successful father-child relationship often requires communication, patience, and understanding.

5. Ang kumbento ang madalas tambayan ni Father at Sister.

6. Humayo kayo at magpakarami! ayon ang biro ni Father Ramon.

7. James Madison, the fourth president of the United States, served from 1809 to 1817 and was known as the "Father of the Constitution."

8. Nasa kumbento si Father Oscar.

9. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

10. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

Random Sentences

1. Kapag walang makain ay naghuhukay ng mga gabi, tugi o anumang halamang ugat sina Karing para maipantawid-gutom.

2. Alas tres ang alis ng tren tuwing hapon.

3. Sweetness can be balanced with other flavors to create a harmonious taste experience.

4. Ipapainit ko ho ito sa kusinero namin.

5. Hindi dapat umasa sa mailap na mga pangako ng ibang tao.

6. Si tienes paciencia, las cosas buenas llegarán.

7. Pangarap ko ang makasakay sa eroplano.

8. Patuloy ang kanyang paghalakhak.

9. Investing refers to the process of allocating resources with the expectation of generating a profit.

10. Nagsisipag-uwian na ang mga mababangis na hayop at ibon sa kanikanilang itinalagang mga lugar nang makita nila si Paniki.

11. Huwag magmadali, namnamin mo ang proseso ng pagkatuto.

12. Kebahagiaan tidak selalu tergantung pada materi atau kekayaan, tetapi pada keadaan batin dan kepuasan diri.

13. The cake was a hit at the party, and everyone asked for the recipe.

14. Inakalang tama ang sagot niya sa pagsusulit, ngunit mali pala.

15. Bawal mag-ingay sa loob ng liblib na lugar dahil ito ay nakakabulahaw sa mga hayop.

16. Maraming mga tao ang nakatambay pa rin sa mga tindahan sa hatinggabi.

17. Gusto mong makatipid? Kung gayon, iwasan mong gumastos sa mga di-kailangang bagay.

18. The police were searching for the culprit behind the rash of robberies in the area.

19. Ang daming adik sa aming lugar.

20. Mathematics is the study of numbers, quantities, and shapes.

21. Kilala ang kanyang ama bilang isa sa mga pinakamagaling na albularyo sa kanilang lugar.

22. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

23. Oscilloscopes can measure not only voltage waveforms but also current, frequency, phase, and other parameters.

24. Bagamat modernong panahon na, marami pa rin ang pumupunta sa albularyo sa kanilang lugar.

25. La science de l'énergie est importante pour trouver des sources d'énergie renouvelables.

26. Nang balingan ng tingin ang matanda ay wala na ito sa kanyang kinatatayuan.

27. People experiencing baby fever may find themselves daydreaming about pregnancy, childbirth, and the joys of raising a child.

28. Naging masaya naman ang dalawa kahit may kondisyon si Cupid na hindi maaaring makita ang kaniyang mukha.

29. Anong oras sila umalis sa Camp Crame?

30. Omelettes are a popular choice for those following a low-carb or high-protein diet.

31. El nacimiento es un evento muy emocionante y significativo en la vida de una familia.

32. Nangahas siyang tumulong sa biktima ng aksidente kahit wala siyang kaalaman sa first aid.

33. Tumahimik na muli sa bayan ng Tungaw.

34. Sinimulan ko ng i-collect lahat ng bibilhin.

35. The students are studying for their exams.

36. No tengo palabras para expresar cuánto te agradezco.

37. Samantalang si Perla naman ay masipag at masinop sa kabuhayan.

38. Les dépenses publiques peuvent avoir un impact significatif sur l'économie.

39. Samantala sa pag-aaral, iniinda niya ang mga pagsubok sa buhay.

40. Hinawakan niya iyon sa magkabilang tirante.

41. Ang mga turista ay madalas magdala ng mapa para hindi maligaw.

42. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

43. Las plantas trepadoras, como las enredaderas, utilizan estructuras especiales para sujetarse y crecer en vertical.

44. Les examens et les tests sont des évaluations importantes pour les étudiants.

45. Balancing calorie intake and physical activity is important for maintaining a healthy weight.

46. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

47. Está claro que la situación ha cambiado drásticamente.

48. It's frustrating when people beat around the bush because it wastes time and creates confusion.

49. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

50. Sa pagkawala ng kanilang tahanan, naghihinagpis ang mga pamilyang apektado ng sunog.

Recent Searches

fathermasasabiberetibiggestwatchingbarriersincreasinglyyelotutoringthanktataastelefonlilipadnabiglakonsyertopakibigayisasamasnasuccesspriestdaladalawritinggumagamitnaiilaganhahatolpinamalagiconmagpakasalsakristanlipadkumikinigmahahanaynananaghilinanahimikmagkikitamagbabakasyontag-ulanairconpisianlabokinalakihanseguridadnovellespandidiripagkagisingtumalonincluirtahimikisinusuotnagtaposusuariopumulotniyospaghettihuwebeskasomapahamakkongkomunikasyonkontrasenioreclipxesumuotautomaticbilingbinilingdilagrealisticveryreservesshowsallottedpetroleumdiddenfriessupilininternaservicesconditioningendpamasahesoftwarepakilagaybetasikmuramatangnapabayaanfulfillmentnapaplastikannagmakaawageneratedmananaogkulotmangkukulamnaupotootumawagnakakalayosuwailpamimilhinkalalakihankilaynakakalasingpinasalamatanpakelamerokumukuhanatutoideaslalargamahawaanlumibotkontratapunongkahoylumindolyonhinigitbakashutestudioapoma-buhaykaramihanlever,kakutisoffentligpaligsahanrinforskelpamanhomespioneerkalayaanganunsumimangotkapagmakakainlumiwanagmagtipidluiskailanganhumalomabutiinventadopaki-drawingechavemagpahababuwalpangyayarimakakawawateknologipagkatakotsasamahansittingmaramotna-curiousnagpapakainnagpapaigibnamumuongkagandahagmaasahanpagkaawamadungisintramurossinaliksiknaiilangbackpackmaglalaroerhvervslivetnanlilisikclubpamanhikanumuwinaliwanaganmedicinemagkaharapyoutube,montrealbintanamahahawabakantedamdaminhinahanapnalugodproductividadnasaanteachingsbihasaibabawkauntiprotegidokumainkaarawansakyanpisaravaliosacantidadnasunogoperativoskatulong