Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "attention"

1. Ailments are a common human experience, and it is important to prioritize health and seek medical attention when necessary.

2. At nakuha ko kaagad ang attention nya...

3. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

4. Dogs are social animals and require attention and interaction from their owners.

5. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

6. Emphasis is often used in advertising and marketing to draw attention to products or services.

7. La santé des femmes est souvent différente de celle des hommes et nécessite une attention particulière.

8. Les personnes âgées ont souvent des problèmes de santé chroniques qui nécessitent une attention particulière.

9. Some critics argue that television has a negative impact on children, as it can lead to decreased attention spans and a lack of physical activity

10. The COVID-19 pandemic has brought widespread attention to the impact of viruses on global health and the need for effective treatments and vaccines.

11. The Cybertruck, an upcoming electric pickup truck by Tesla, has garnered significant attention for its futuristic design and capabilities.

12. The model on the runway was a beautiful lady who effortlessly commanded attention.

13. The pretty lady walking down the street caught my attention.

14. Women's health issues, such as reproductive health and breast cancer, have received increased attention in recent years.

Random Sentences

1. Sí, claro, puedo confirmar tu reserva.

2. Sapagkat misyunero, marami ang naliwanagan sa katotohanan.

3. Higupin mo muna ang sabaw bago kainin ang noodles.

4. El agua es utilizada en diversas actividades humanas, como la agricultura, la industria y el consumo doméstico.

5. Naglalakad kami sa baybayin ng dagat sa hatinggabi at nasisilayan namin ang magandang tanawin ng buwan.

6. Hindi ako usually ganto, pero sana pwede ba kita makilala?

7. It's complicated. sagot niya.

8. Tila uulan ngayong hapon dahil sa madilim na ulap sa langit.

9. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

10. Gumawa si Mario ng maliit na bola mula sa papel.

11. I have an important interview today, so wish me luck - or, as they say in the theater, "break a leg."

12. Nagbuwis ng buhay ang ilang bayaning pilipino makamit lang ang araw ng kalayaan.

13. Saan nakatira si Ginoong Oue?

14. Higit kong daramdamin kung ako na itong nagawan ng di mabuti ay sa kanya pa manggagaling ang huling salita.

15. Nakakatawa? mataray na tanong ko sa kanya.

16. Si Maria ay nag-aapuhap ng tulong sa kanyang mga kaibigan para sa isang charitable event.

17. Ipagtimpla mo ng kape ang bisita.

18. Helte kan være en kilde til inspiration og motivation.

19. Nagka-bungang-araw si Baby dahil sa sobrang init.

20. Magkita na lang tayo sa library.

21. Le musée d'Orsay est un incontournable pour les amateurs d'art.

22. En helt kan være enhver, der har en positiv indflydelse på andre mennesker.

23. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

24. Oo na. Umuwi ka na. Di ko na ipapaputol ang card mo.

25. Es difícil saber lo que pasará, así que simplemente digo "que sera, sera."

26. Les patients peuvent être transférés dans des unités de soins spécialisées en fonction de leur état de santé.

27. Dahil sa pagod, naupo ang matanda sa ilalim ng nasabing puno upang makapagpahinga.

28. Gumawa si Tatay ng makukulay na saranggola para sa piyesta.

29. A pesar de su mala reputación, muchas serpientes son inofensivas para los seres humanos y desempeñan un papel crucial en la naturaleza.

30. Omelettes can be enjoyed plain or topped with salsa, sour cream, or hot sauce for added flavor.

31. Bakso adalah bola daging yang disajikan dengan mie dan kuah kaldu.

32. Madalas na mayroong propaganda sa panahon ng digmaan upang mapalawak ang suporta ng mamamayan.

33. Ang mga senior citizen ay dapat na itinuring at respetuhin dahil sa kanilang karanasan at kontribusyon sa lipunan.

34. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

35. Pati ang mga batang naroon.

36. Vi skal fejre vores helte og takke dem for deres indsats.

37. May natagpuan umanong bagong ebidensya sa kaso ng pagkawala ng bata.

38. Baby fever can also be influenced by societal and cultural norms, as well as personal experiences and values.

39. Ang matandang babae ay pinagpalaluan ng buong barangay dahil sa kanyang karunungan at malasakit.

40. Malapit na matapos ang kanyang termino sa pagka senador.

41. Ang guro ko sa agham ay mahusay sa pagpapaliwanag ng mga konsepto.

42. Nagtatrabaho ako sa Mimosa Family Home.

43. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

44. We have visited the museum twice.

45. El nacimiento de un bebé trae consigo la alegría de ver crecer y desarrollarse a un ser humano.

46. Hindi siya makabangon at makagawa ng gawaing bahay.

47. Paborito ko kasi ang mga iyon.

48. They go to the library to borrow books.

49. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

50. Sopas ang ipinabalik ko sa waiter.

Recent Searches

attentionxixnakabuklatinutusantingingtirahanpagapangindvirkninghuwagsorpresasighmakipagtalodisentepatakasnasasabinglegislativebinabalikyelonagkabungapicsisinaboyredesipagbilidividedquezonmumuntingmakabalikmachineskumaenalmacenarlangyajackzikawsubject,palitannapapikitdalatensalitaputilargeerrors,regularmenteonlydositlogpanggatongpaglingonnapatigninibinubulongitsmerekakutisgustonggraduationfitnesscharmingtumingalatelangsinongserpaksanatupadnapapatinginmakisiglumabasjulietinantokhimgasmengabefarmenglishbeautyahitvehiclesshocksakinrememberedpasigawnagwagimarahilmangingisdamakauuwilipadglobalisasyonkinalimutanpaglayaskaybilisbaldeadvancesinabipebreronearnaglabaelectditocardiganpinalakingmorenapilipinopuntahankumakalansingcrazyexperts,tanggalinapelyidohverhiramworknagsisigawmagdilimyakapnakatawagakmainternalferrerkendidakilangnasilawemphasisboyfriendnapilifindelasasectionsingatanmadurassumayanilulonsinampaleasynandunlagingkilongkinalalagyanpaghuhugasbalahibonewhuluseelandmaawanagtitiistillpinasalamatanpagkatakotmagkamalina-suwaysasamahankalayaannalalarotinitirhannakasakaypagkamanghanagwelganapakagandakasaganaannanghihinapinagpatuloyleverageexporthayaanactualidadnakakamitnangangalitmagsusuotdumagundongentrancemaglalarogulatpamanhikannakilalanaliligomaasahanpeksmanumiisodgumisingmadadalaakmanggagamititinaobmahulogukol-kaypakanta-kantamahiligoperativosdireksyonnasunogtelecomunicacionestherapeuticsplatovotesdawmegethearsuffertuwingalagangdetallan