Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "transmitidas"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

2. Nagluto ako ng adobo para kina Rita.

3. ¿Puede hablar más despacio por favor?

4. Bumuhos ang pawis niya sa sobrang gutom at naglalaway na siya.

5. Kelangan ba talaga naming sumali?

6. Ano ho ang gusto ninyong orderin?

7. Sa kabila ng mga pagsubok, hindi siya sumusuko at pinagsisikapan na mapabuti ang kanyang buhay.

8. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

9. Hun er utrolig smuk. (She is incredibly beautiful.)

10. Der kan være aldersbegrænsninger for at deltage i gamblingaktiviteter.

11. Limiting alcohol and caffeine intake can improve overall health.

12. Ang librong ito ay ukol kay mam Luisa na nagbigay inspirasyon sa kanyang mga estudyante.

13. Wer nicht wagt, der nicht gewinnt.

14. Kailangan ko umakyat sa room ko.

15. Inabot ko naman yung pinggan. Anim na hotdog ang nandun.

16. Acts of kindness, no matter how small, contribute to a more charitable world.

17. Walang sinasabi ang mga ito, ngunit sa mga mata, sa galaw ng mga labi nababasa nya ang isinisigaw ng mga paslit.

18. Vaccines are available for some viruses, such as the flu and HPV, to help prevent infection.

19. Nahuli na kahapon ang nagnakaw ng kalabaw ni Mang Arturo.

20. Ang pagkakalugmok sa pag-aakala ng mga kasinungalingan ay nagpapakita ng pagiging bulag sa katotohanan.

21. Tuluy-tuloy niyang tinungo ang hagdan.

22.

23. She has written five books.

24. Representatives often collaborate with other officials and stakeholders to achieve common goals and address broader societal issues.

25. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

26. Nationalism has been a driving force behind movements for independence and self-determination.

27. Det er også værd at bemærke, at teknologi har haft en stor indvirkning på vores samfund og kultur

28. Algunas plantas son comestibles y se utilizan en la alimentación, como las frutas y verduras.

29. Puwede bang makausap si Clara?

30. I do not drink coffee.

31. La realidad siempre supera la ficción.

32. Ang tubig-ulan ay maaaring magdulot ng pagkakasakit kung hindi magiging maingat sa pag-inom nito.

33. Nakapila ako sa bayad center upang magbayad ng kuryente.

34. Tinulungan ko siyang dalhin yung mga plato sa dining room.

35. Repeated frustration can lead to feelings of hopelessness or helplessness.

36. Estoy muy agradecido por tu amistad.

37. Huwag kang maniwala dyan.

38. She is playing the guitar.

39. Las plantas con flores se reproducen a través de la polinización, en la que los insectos u otros agentes transportan el polen.

40. Users can follow other accounts to see their tweets in their timeline.

41. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

42. Ang pag-aaral ng tao ay hindi lamang sa labas kundi pati sa kaibuturan ng kanyang pagkatao.

43. Investing refers to the process of allocating resources with the expectation of generating a profit.

44. Los héroes son reconocidos y celebrados por su valentía y altruismo.

45. Cutting corners in your exercise routine can lead to injuries or poor results.

46. Vi skal fejre vores helte og takke dem for deres indsats.

47. The objective of hockey is to score goals by shooting the puck into the opposing team's net.

48. Elektronikken i en bil kan hjælpe med at forbedre kørsel og sikkerhed.

49. Kapag mayroon kang kaulayaw, hindi ka mag-iisa sa mga pagsubok na iyong kinakaharap.

50. Humingi ng tulong ang magsasaka sa albularyo dahil naniniwala siyang may kulam sa kanyang hayop.

Recent Searches

transmitidasiconickrusmakalawabosesdevicesjerrymulawareclassmateresponsiblethoughtskapilingdifferentexampletechnologicalhila-agawanpangungutyamagasawangnanahimiknakahigangmonsignorpagpanawpaghihingalotreatsmagpagalingnauliniganinaabutanteknologipaghangaartistsumusulatpamasahesakitwarihahanapinnakapaligidmagtagokamandagtabingumiibigtinahakusuariotsakakailanmanpapayagawaingcitizencarriesallemawalaumabothumihingisimplengdiyoskasaysayankasuutankontingzooopodibaseniornamulatpolopakilutoburmaroommurangfeltofficetherapybastadumikitsquattertutorialsmuchosdahonringayundinkayang-kayangkinakainmagbabayadnapakagagandaagricultorespagkakayakapsinasadyanakadapamakalipassoftwarebangladeshhandaankanikanilangpumitassanggollumakasika-50kainitanmagselositinaaskatibayangkumantaabigaelmahigitbayaningannikamatangkadninacomunicarsereguleringmalapitancolornilolokoredigeringbarosemillasalaalabuwansantoeliteorderinpasancoinbaseasimpostcardfascinatingtrainingexpectationsvancontrolledumilingtechnologiesagam-agamglobalisasyonibinubulongkinabubuhaymatapobrengtagumpayresignationnapasigawnami-misspagkagisingtutoringemphasisbalediktoryanmartiannaglokohanpakistannaglulusakkababalaghangnakapikitanilatilamaghintaypatiencetinitirhansetyembreprovidedxixbevareburgernaghandanghusonagbungabumabaiosrelativelycrazysugalnapadungawgitarafrogsofasecarsemasayang-masayaakmangpagtatanimnakakitamagbayadtutungonandayaisasabadsonidosaan-saanpagbabayadmagbaliknakitulogkisapmatauulaminreahpakibigyanbasketballlilipadtawakutsaritangtataasgaanonahulaanmakulitgrinsaircon