Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "transmitidas"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. Ang mga nagtatagumpay sa negosyo ay madalas na itinuring bilang mga modelo ng tagumpay at inspirasyon para sa iba.

2. Tuwing may sakuna, nagkakaisa ang mga Pinoy sa pagtulong sa kapwa.

3. The guilty verdict was handed down to the culprit in the embezzlement trial.

4. His first hit, That's All Right, was released in 1954 and quickly climbed the charts

5. William Henry Harrison, the ninth president of the United States, served for only 31 days in 1841 before his death.

6. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

7. Han er den eneste, jeg nogensinde har været forelsket i. (He's the only one I've ever been in love with.)

8. Antes de irme, quiero decirte que te cuídes mucho mientras estoy fuera.

9. La labradora de mi sobrina es muy amigable y siempre quiere jugar con otros perros.

10. Di-kalayuan sa gripo ay may isang tindahan.

11. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

12.

13. He was busy with work and therefore couldn't join us for dinner.

14. Sobrang mahal ng cellphone ni Joseph.

15. Después de leer el libro, escribí una reseña en línea.

16. Il n'y a pas de méthode unique pour maintenir la motivation, car chaque individu est différent et doit trouver ce qui fonctionne le mieux pour lui.

17. Nag-iisa kasing anak si Ranay.

18. La serpiente de coral es conocida por sus llamativos colores y patrones, pero también es altamente venenosa.

19. Tesla was founded by Elon Musk, JB Straubel, Martin Eberhard, Marc Tarpenning, and Ian Wright.

20. Isa-isa niyang tiningnan ang mga nakapaligid sa kanya.

21. Malaya na ang ibon sa hawla.

22. Anong klaseng kuwarto ang gusto niya?

23. All these years, I have been reminded of the importance of love, kindness, and compassion.

24. Hindi. Ipinangangak ako sa Cebu.

25. Nagkwento ang lolo tungkol sa multo.

26. Hindi ito maganda na maging sobrang takot sa lahat ng bagay dahil lamang sa agam-agam.

27. Nagitla ako nang biglang nag-crash ang kompyuter at nawala ang lahat ng aking trabaho.

28. Napaluha si Aling Pising nang makita niya ang bunga nito.

29. Ang mga medical technologist nagsisilbi upang magbigay ng tumpak na resulta sa mga laboratory tests.

30. I was going to surprise her, but I accidentally spilled the beans.

31. Bago pa man napigilan ng bata ang babae ay naisubo na nito ang puting laman ng bunga.

32. Ngumiti siya ng malapad sabay hagikgik.

33. Los océanos contienen la mayor cantidad de agua en la Tierra.

34. Las escuelas también tienen la responsabilidad de asegurar un ambiente seguro para los estudiantes.

35. Håbet om at finde vores sande formål kan føre til stor personlig opfyldelse.

36. Ang sugal ay isang problema ng lipunan na dapat labanan at maipagbawal para sa kapakanan ng mga tao.

37. Las pinceladas sueltas y rápidas le dan a la pintura un aspecto más dinámico.

38.

39. Bilang paglilinaw, hindi ako nagsabi na aalis ako, kundi lilipat lang ako ng departamento.

40. Alam ko maraming uncertainties sa buhay, pero sana pwede ba kitang mahalin?

41. Erfaring har vist mig, at det er vigtigt at have en positiv tilgang til arbejdet.

42. He served as the 45th President of the United States from 2017 to 2021.

43. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

44. Malikot ang kanyang mga mata nang siya'y bumangon at itukod ang mga kamay sa semento.

45. Ahhh...wala! Bakit ba, nagdadasal ako noh!

46. Nagpamasahe siya sa Island Spa.

47. Trump's immigration policies, such as the travel ban on several predominantly Muslim countries, sparked significant debate and legal challenges.

48. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

49. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

50. Ketika menghadapi tantangan hidup, penting untuk menjaga keseimbangan antara kerja keras dan istirahat yang cukup.

Recent Searches

transmitidasordermaynilaatmag-alasgawintanganramdamgabingibigriskmakakatulongmanuelablemagigitingmethodsmanatilitechnologicalnakaluhodskypetsinelaspahabolbihiradaangkasalukuyanbarangayslaveninyoposts,tayokabosessenatengunitkinalilibinganperfectipinanganakpulisnagkalapitwasteiilangonghatinggabisirkagalakannakatagonogensindetanggalinpagkakamalichoosebosesanitosumakaykangkongnagmamadalienterumokaywordskambingnabiglaflyvemaskinernamilipitnakalilipasorderinpangetbihirangproducekaninomakipagtagisansumagotistasyonbillganaatetelaflytaga-tungawcoachingcolourmakaiponsakinpatuloyconstantjuegoskakayananmataraycarlobranchesmag-aaralipipilitulocommunicaterawsayamatatandamatangumpaymaghintaykumaenmagkanonag-aabangnakapapasongknow-howano-anoseryosongmalawakyumao1940leytelagunatelangaudio-visuallysalu-salotenidoninadinanasnuevoawtoritadongtelevisionpshcongresstelebisyonrenacentistaarteparaisonabigaypumansinyumabangnatulalaumagangconvertidasipagbilimagsalitamataoffentligekatapatkakaantaykanserinintayknownnakakasamanagtalagauniversitiesctricassinekalakihanpagsisisiqualitybituintracklumusoberrors,ginagawamegetnangyarileftmesayanglagiabalapossibletinderatraveladditionally,neverfederalwhetherlumitawpinoyelectionsdekorasyonconstitutionkomedorlagaslaskahusayansulatlamesatanyagsumigawnaglahopaydressfieldprincipaleslabisgrabereaksiyonnararapatpinagpatuloyairconagaw-buhayyumuyukotheypapasaexperience,carriedmaaringamazonprogresspasyentelasinghardinsapatos