Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "transmitidas"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. AI algorithms are constantly evolving and improving, with new advancements being made in fields such as deep learning and reinforcement learning.

2. Les enseignants peuvent encadrer des clubs étudiants pour promouvoir les compétences sociales et artistiques des élèves.

3. Sa iyong pagdating, lumiwanag ang aking mundo.

4. I am absolutely confident in my ability to succeed.

5. Les employeurs peuvent promouvoir la diversité et l'inclusion sur le lieu de travail pour créer un environnement de travail équitable pour tous.

6. The company's CEO announced plans to acquire more assets in the coming years.

7. The company's growth strategy is focused on acquiring more assets.

8. Kain na tayo. yaya ni Maico sa amin.

9. We need to address the elephant in the room and discuss the budget issues.

10. Pangkaraniwang Araw sa Buhay ng Isang Tao

11. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

12. Today, Presley is widely considered to be one of the most important figures in American music and culture

13. La science des matériaux est utilisée dans la fabrication de nombreux produits de la vie quotidienne.

14. Drømme kan inspirere os til at tage risici og prøve nye ting.

15. Representatives engage in negotiations and compromise to find common ground and reach consensus on complex issues.

16. Sa pagguhit, hindi kailangan na perpekto ang mga linya at kulay mo.

17. Bawal magpaputok ng paputok sa hindi pagkakaroon ng pahintulot ng lokal na pamahalaan.

18. Después de la reunión, tengo una cita con mi dentista.

19. Coffee is a popular beverage consumed by millions of people worldwide.

20. A couple of raindrops fell on my face as I walked outside.

21. Sa pagkakaroon ng kalamidad, ang mga biktima ay nag-aapuhap ng emergency relief mula sa mga rescue teams.

22. Napapikit ako at naglabas ng malalim na himutok upang maibsan ang aking pagod.

23. The director shouted "break a leg!" as we went onstage.

24. Ang sugal ay isang mapanlinlang na industriya na nakatuon sa pagkuha ng pera mula sa mga manlalaro.

25. Nasaan ba ang pangulo?

26. Patients may be hospitalized for a variety of reasons, including surgery, illness, injury, or chronic conditions.

27. "Let sleeping dogs lie."

28. Hindi dapat umasa sa mailap na mga pangako ng ibang tao.

29. May tawad. Sisenta pesos na lang.

30. Isang araw nagkasakit si Aling Rosa.

31. Hindi ninyo madadala sa hukay ang yaman ninyo.

32. Ikinagagalak naming anyayahan kayo sa aming kasal.

33. Nagbabakasyon ako tuwing Abril.

34. The park has a variety of trails, suitable for different levels of hikers.

35. If you don't want me to spill the beans, you'd better tell me the truth.

36. The invention of the telephone led to the creation of the first radio dramas and comedies

37. El agricultor utiliza técnicas de riego para asegurar el crecimiento óptimo de sus cultivos.

38. Les enseignants sont des professionnels de l'éducation qui travaillent dans les écoles.

39. Nanalo siya ng Palanca Award para sa panitikan

40. Makakarinig ka ng halinghing sa gym, lalo na kapag may nagta-training ng cardio.

41. Puwedeng dalhin ng kaibigan ko ang radyo.

42. No te alejes de la realidad.

43. Sweetness can evoke positive emotions and memories, such as childhood nostalgia.

44. Ang pagiging malilimutin ni Tina ay minsang nagiging dahilan ng kanyang pagkahuli.

45. We didn't start saving for retirement until our 40s, but better late than never.

46. Doa dapat dilakukan oleh siapa saja, tanpa memandang agama atau keyakinan.

47. Hashtags play a significant role on Instagram, allowing users to discover content related to specific topics or trends.

48. Sa pagpaplano ng kasal, kailangan isaalang-alang ang oras ng seremonya upang hindi maabala ang mga bisita.

49. Kikita nga kayo rito sa palengke!

50. Jeg har opnået stor erfaring gennem mit arbejde med at lede projekter.

Recent Searches

tsetransmitidaspumatolmadamilumiwagatensyonguncheckednatingalaorasbasahanmatchingipagamotso-calledbriefwalislargerpinatayparagraphsramdamdollyremotedoescomplexstringmakingtechnologicalconsiderlearnkisapmatacontentmainstreamgotspendingmahulogpagkaraapinakainhulyodisyembrenakaluhodsakyanzoomseparationmagta-trabahonagkalapitpwedenerosayudanagsiklabsiglaalapaapnaghubadtinungoyou,generationersignalexpandedpinapalogirlfriendaccuracybeachsponsorships,balahibokarnabaldumilimitinaasnakakasulatmag-ibamamuhaykirotinommalusognapatulalanareklamodrowingkeepingstreetpigilanpagpasensyahanminsankwebangaspirationnaidlipmakikipagbabaggreatlyhaloskaawa-awangmasaktanmananalosinampalgatheringearnpaaanykasalukuyangkayangmaaksidentekastilakakayanannapuyattabingadgangyouthmagtiwalapumitassinasadyasalatincancerbagamapautangmumuntinglalokilaymahuhulilansanganhinihintayalas-dosnanunuksopatakbowalkie-talkiekakuwentuhanikinagagalakmagbagong-anyokalalakihannakalilipastuluyankinapanayamnapakahusaymagkakaanakkonsentrasyonnag-aalalangpodcasts,easierkaagadnapakabaittungawpagmamanehonagsagawapagkapasoknakapaligidiba-ibangmiyerkolessaaneducativassumusunodpag-aaniekonomiyamagamotkalupilookedawtoritadongdistancesumusulatmagdilimipinambilidyosatraditionalpesosipinansasahogmaawaingnatalodalhanmarurusinghikinggrowthadecuadomaatiminastatawatatlovelfungerendepupuntahanpapernatagalanmaghapongihahatidhumiganakahainhellobiliscolorkumbentoinimbitalalakekasalananhoypangkathastawinsinihandariyanpintowastenataposcarbonbateryabulakiniibigtamapambansanghjem