Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "transmitidas"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. Inakalang ligtas ang lugar, pero may paparating palang bagyo.

2. Walang 'tayo' Maico. Kaya please lang iwan mo na ako.

3. Inalagaan niyang mabuti hanggang sa ito'y magbunga.

4. Ano hong klaseng sawsawan ang gusto ninyo?

5. Tara na nga Hon! Mga baliw ata yan eh!

6. Les systèmes de recommandation d'intelligence artificielle peuvent aider à recommander des produits et des services aux clients.

7. The first dance between the bride and groom is a traditional part of the wedding reception.

8. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

9. Nagtataka ako kung bakit hindi mo pa sinasabi sa akin ang totoo.

10. Kumain ako ng macadamia nuts.

11. I love to celebrate my birthday with family and friends.

12. Tak ada gading yang tak retak.

13. A couple of cups of coffee in the morning help me start my day.

14. Kanina pa kami nagsisihan dito.

15. Ariana Grande is an American singer, songwriter, and actress known for her wide vocal range and powerful voice.

16. Las escuelas promueven la inclusión y la diversidad entre los estudiantes.

17. "Every dog has its day."

18. Proper maintenance, such as regularly oiling the pivot point and cleaning off debris, can prolong the lifespan of scissors.

19. Ang mga engineer nagsisilbi upang mag-disenyo at magtayo ng mga imprastraktura para sa publiko.

20. Overcoming frustration requires patience, persistence, and a willingness to adapt and learn from mistakes.

21. Maarte siya sa mga hotel na tinutuluyan kaya hindi siya nakikipagtipon sa mga backpacker's inn.

22. La creatividad nos lleva a explorar nuevos caminos y descubrir nuevas posibilidades.

23. Napakahalaga ng pag-unlad ng mga pagsasaliksik sa talambuhay ni Apolinario dela Cruz bilang isang relihiyosong lider.

24. It was founded by Jeff Bezos in 1994.

25. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

26. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

27. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

28. Tatanghaliin na naman bago siya makasahod.

29. Her album Thank U, Next was a critical and commercial success, debuting at number one on the Billboard 200 chart in 2019.

30. Ang poot ay sumisindi sa aking puso sa tuwing naalala ko ang mga pagkakataon na ako'y iniwan at sinaktan.

31. Kailangan mong umintindi ng kaibuturan ng kanyang pagkatao upang magkaroon kayo ng mas malalim na ugnayan.

32. Medyo kakaiba ang pusang ito sapagkat makapal ang kulay dalandan na balahibo.

33. Paglingon ko, nakita kong papalapit sakin si Lory.

34. Mamimili si Aling Marta.

35. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

36. Bakit naman kasi ganun ang tanong mo! yan ang nasabi ko.

37. Emphasis can be used to highlight a person's strengths and abilities.

38. Marahil ay kailangan mong magdagdag ng oras sa pag-eensayo upang makamit ang iyong layunin.

39. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

40. Danske virksomheder, der eksporterer varer til USA, har en betydelig indvirkning på den amerikanske økonomi.

41. Ngunit marumi sila sa kanilang kapaligiran.

42. Nangyari ang aksidente sa daan kahapon kaya maraming sasakyan ang naabala.

43. Madilim ang kweba na kanilang pinasok.

44. Kasya kay Suzette ang blusang na ito.

45. Ang buong kagubatan ay nagliliwanag sa tama ng mga ilaw ng parol ng mga Alitaptap.

46. Oo malungkot din ako. Mamimiss kita.

47. Magkapareho ang kulay ng mga bag namin.

48. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

49. Matapos ang pagtatanghal, bagamat di man lang siya makangiti at makatawa, kitang-kita sa kaniyang mata ang kasiyahan.

50. It was founded in 2012 by Rocket Internet.

Recent Searches

pisotransmitidassino-sinomangconventionalinumindonhadofte18thwellpalagingpanguloinalokpasyaelectionstomarconvertidasreservedbokpumuntatheminfluenceanimguiltyjunioipagtimplaarmedmonetizingcheckssafemapadaliakinbaddaratingrestdinggindividesmind:kagabisourceprogramming,tutorialsinitspecificeditorsystemsettingextraneverinternatooltechnologicalfacequalitywhypinakamahalagangmagpa-picturedegreestataynagpipiknikuniversitieshorsenapahintoiyamotimportantepasaheroalinfurvictoriasectionsyarimaatimnakipagpagbigyanlumulusobkrustutoringcomputersSapasoccerdaanbotebilerservicesnegativekahaponbilingcontinuenagbabakasyonnagtitiisnanghahapdikomunikasyonkakuwentuhandamitsumamabalitamapayapalimosstrengthnakikihukaycultivarhitsurajobsnag-aaralbangladeshpaki-translatecarsnanghihinanagpakitaanak-pawisnageenglishgayunmansapatosdelekare-karenalakikumakantadiretsahangdoble-karahiwatangekspagtawamagkasabaypagkapasokiintayinnamumulotiwinasiwassumakaypaghuniunanisinaraconclusion,hanapinnabigaylandassiguradomahirapalagangsurveyslikodumiwasintensidadhurtigereprimeroskasamahandilimlayuanbopolssiraentertainmentbisikletanabiglasahodhunikainanbanlagcurtainsnatalopaakyatgustongemphasizedmagkakaanakexcitedtulalaheartbreakkatapatkindsmatulisnaglabananayawyourself,natulakhagdanbaryokuwebapalakaproductsmanilayoutubemaarawbumotoosakamembersmanuksomalambingmaskijenamalumbayeclipxepatunayanpalangnahihilodenneganangatensyonggustoumigibyepkanto