Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "transmitidas"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. The Tesla Roadster, introduced in 2008, was the first electric sports car produced by the company.

2. Palibhasa ay madalas na masigasig sa pagtuklas ng mga bagong kaalaman at ideya.

3. Tumango siya at nagsimula nang kumaen.

4. Mange små og mellemstore virksomheder i Danmark eksporterer varer og tjenester.

5. Motion kan også hjælpe med at reducere risikoen for visse sygdomme, såsom type 2-diabetes, hjertesygdomme og visse former for kræft.

6. Scissors should be kept sharp to ensure clean and precise cuts.

7. Mas masaya naman ako pag napapasaya kita eh.

8. Es importante educar a los jóvenes sobre los riesgos y peligros del uso de drogas.

9. Sueño con tener un estilo de vida saludable y activo. (I dream of having a healthy and active lifestyle.)

10. Scientific analysis has revealed that some species are at risk of extinction due to human activity.

11. Si Ogor, Impen, pahabol na bilin ng kanyang ina.

12. Nous avons prévu une séance photo avec nos témoins après la cérémonie.

13. Hindi natinag si Kablan sa loob ng kanyang tindahan.

14. Børn er en vigtig del af samfundet og vores fremtid.

15. Naglalaba siya ng mga kumot at kurtina upang mapanatili ang kalinisan ng aming tahanan.

16. Gusto ko sanang ligawan si Clara.

17. Det er vigtigt at respektere og anerkende transkønnede personers kønsidentitet og bruge deres præfererede pronominer og navne.

18. Mahalaga na hindi tayo mawalan ng pag-asa sa ating mga pangarap.

19. Ang mahiwagang pagsagot ng prinsipeng tila ba mag agam-agam.

20. Les enseignants ont un impact majeur sur la vie des élèves et leur réussite scolaire.

21. Hindi ko naabutan ang dakong huli ng pagbubukas ng tindahan.

22. Kapag mahangin, inililipad nito ang mga dahon palayo sa halamanan.

23. Sa pagguhit, mahalaga ang pagpili ng tamang anggulo at perspektiba.

24. Mula noon ay laging magkasama ang dalawa.

25. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

26. Women have diverse perspectives and voices that can enrich society and inform public policy.

27. Pumitas siya ng isang bunga at binuksan iyon.

28. The management of money is an important skill that can impact a person's financial well-being.

29. En casa de herrero, cuchillo de palo.

30. Bumili ako ng bagong set ng kubyertos para sa aming bahay.

31. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

32. Dahil sa alam nito na magaling siya sa kanyang kakayanang paghahabi hinamon nito ang sino man na magkipagtagisan sa kanya.

33. Tesla has a strong and passionate community of supporters and customers, known as "Tesla enthusiasts" or "Teslaites."

34. Narinig ng mga diyosa ang kayabangan ng bata.

35. Maganda ang mga bulaklak sa tagsibol.

36. Scientific inquiry is essential to our understanding of the natural world and the laws that govern it.

37. She has been tutoring students for years.

38. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

39. Magkano ang tiket papuntang Calamba?

40. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

41. Itinapon nina Fred at Melvin ang basura

42. Durante el invierno, las personas usan ropa más abrigada como abrigos, gorros y guantes.

43. Binentahan ni Mang Jose ng karne si Katie.

44. Paano kung hindi maayos ang aircon?

45.

46. Cancer can affect any part of the body, including the lungs, breasts, colon, skin, and blood.

47. Ano ang gagawin mo sa Linggo?

48. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

49. Masaya akong napanood ko na live ang pagkanta ng Bukas Palad sa isang fundraising event.

50. Me encanta enviar tarjetas de amor en el Día de San Valentín a mis amigos y seres queridos.

Recent Searches

sawasuottransmitidasdyanstillfurychavittools,talentednyadalawsaancommunityexpectationsdaigdigbakeactingauditadventburdenirogcebutandaleaddevelopbroadcastsconsiderextraentercommunicatebagkusconstitutionparatingkailananiturodurifloorumakyatintsikreplacedmagsasakanagkantahanlumbayonceibabawpitongdragonmagbagong-anyopulubinaglokohanbiggestjuanhangaringseriousmongcalidadiiklilockdownioschangemovingcanadaattentionbeganbuslofar-reachingnasabinglaboryelonahulisumabogeventssinunodsectionspondomagpa-pictureleahhumanoniyonspiritualnakakagalingbarung-barongnapaplastikansalarinnagtatanongopgaver,tumawagtatawagobserverernapapalibutanmaabutangumigisingmakawalaonline,pinigilantinikmanligayaadvancementkalabanindustriyapangangailangannuevosniyodescargarpiyanoisinarapatunayanpeppynatayoquarantinerequierennatutuwamarinigpaghuhugasprotestasiyambrasomusiciansgymentertainmentnasuklamkumatoknenakatagakulotmarangyangkelanmagisingplasafulfillingitongpagsusulatperwisyopaginiwannakakapuntadeliciosatignanbornpaumanhindisplacementkristodipangtinderaaniyaneed,ipinasyangmalakiearningcomoutilizarnag-umpisapookthenzoompicsadditionmagagamitunatumutubokarnaballinesutilspendinghanalamsettinggeneratednariningknowinterpretingstudiedfauxartistgagamitemphasistindahanbotomrsbinibilangkinalimutansilangyepposterumigtadcharismaticpoottawalumiitkalikasaninamainstreamgusalikinagigiliwanggrammarpamumunopakaincandidatesbuhokkarunungan