Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "transmitidas"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. El aloe vera es una hierba medicinal conocida por sus propiedades curativas para la piel.

2. La science de l'informatique est en constante évolution avec de nouvelles innovations et technologies.

3. Sumakay kami ng kotse at nagpunta ng mall.

4. Pasensya ka na anak, ang lahat ng ginagawa namin ng iyong ama ay para sa iyo.

5. At blive kvinde handler også om at lære at håndtere livets udfordringer og modgang.

6. Hinahabol ko ang aking hiningang mahina dahil sa kalagitnaan ng marathon.

7. Ang bunga ng kakaibang halaman at tila ba kamay na nag-iimbita.

8. Dalawang libong piso ang palda.

9. Pag-akyat sa pinakatuktok ng bundok.

10. Nang mabangga ang kotse, kumaripas ang driver para umiwas sa responsibilidad.

11. Gaano katagal ho kung sasakay ako ng dyipni?

12. Nasa ilalim ng mesa ang payong.

13. She has made a lot of progress.

14. Helte kan have en positiv indflydelse på hele samfundet.

15. Bagaimana cara memperbaiki mesin cuci yang rusak? (How to fix a broken washing machine?)

16. Sa gitna ng kaniyang pag-aaral, napadungaw siya sa katabing silid at nakita ang kanyang kaibigan.

17. Sa mga matatandang gusali, naglipana ang mga alamat at mga kuwento ng nakaraan.

18. Anong lugar ang pinangyarihan ng insidente?

19. En invierno, los árboles pierden sus hojas y se vuelven caducos.

20. At naroon na naman marahil si Ogor.

21. Después de haber viajado por todo el mundo, regresé a mi ciudad natal.

22. Inflation kann auch durch eine Verringerung des Angebots an Waren und Dienstleistungen verursacht werden.

23. Ang pagpapahalaga sa ating kalikasan ay mahalaga para sa kinabukasan ng susunod na henerasyon, samakatuwid.

24. La labradora de mi colega es muy sociable y siempre se lleva bien con otros perros.

25. The most famous professional basketball league is the NBA (National Basketball Association), which is based in the United States.

26. A portion of the company's profits is allocated for charitable activities every year.

27. Sweetness can also be found in natural sweeteners, such as honey and maple syrup.

28. Tuwing tag-init, maraming bata ang naglalaro ng saranggola.

29. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

30. Camarón que se duerme, se lo lleva la corriente. - You snooze, you lose.

31. mga yun. Ang mahalaga ay makapagempake ako agad.

32. I am listening to music on my headphones.

33. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

34. Libre ba si Carol sa Martes ng gabi?

35. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

36. Hindi malaman kung saan nagsuot.

37. We have visited the museum twice.

38. Para sa malilimutin, malaking tulong ang paggamit ng alarm sa cellphone.

39. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

40. Ang pangamba ay kadalasang sanhi ng hindi pagpapakatotoo sa ating mga nararamdaman at saloobin.

41. Ang pag-asa ay isang mahalagang emosyon na nagbibigay ng lakas at inspirasyon sa mga tao.

42. William Henry Harrison, the ninth president of the United States, served for only 31 days in 1841 before his death.

43. Gumanda ka lalo sa kulay ng suot mo.

44. It's a piece of cake

45. L'intelligence artificielle peut être utilisée pour aider à la planification urbaine et à la gestion des transports.

46. Claro que puedo acompañarte al concierto, me encantaría.

47. Sa buong buwan ng Disyembre, ang mga mall ay hitik sa mga pamaskong dekorasyon at mga regalo.

48. Her music career took off with her debut album Yours Truly in 2013, featuring the hit single "The Way."

49. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

50. Sa bawat tugtugin ng kundiman, nabibigyang-katarungan ang mga pinagdaanang sakit at luha ng mga taong nagmamahalan.

Recent Searches

transmitidaspalagiparopancitdaladalaneed,katedralnangcassandracasasemillaskrusbestgranadadiscoveredklimabingosumakaykagandapumatolfameaniyatshirtpatisupilinmaskipriestsawaprutassilanggoalbutchnicohomesmapahamakmembersinterestsapoynunpakealamayokoeeeehhhhcornerssinongcebuipinikitpasalamatanbipolarbarrierslarryhumanosdrayberprovematangfreelancerconvertidasbinabalikelectionstryghedschoolsotrasibalikstarnitongnatingalawatchinghigitbroughtmasdanwowspeechesnamulambilinlamesakamatisownpakaindalawkapiranggothighestnatanggaptoothbrushtaposandamingindividualasulgamotaccederjudicialstaplebisigpartyitongbangrabelutopinyaallottedsearchusalawsallowingbagyopitowaysaidamparoipinadalaresignationwordyepubodtonightgreatramdambusiness,kadaratingauditalttabistoreellenputahegamefiguresgenerationerilancommunicationlackbelievedworryfansstrategyvedbranchespasangcondoginisingpasokcompartenconsideredbeinteideyaknowssamudontgoddesdeshowmagbungasorryreservedhihigamakagawaanisyncsourceandroidautomaticprocesswhileneedssolidifyulingeffectmapmethodsthirdcurrentinitshiftfallabinilingtwoexistconvertinghateworkshopitemsplatformpasinghalhalosandycontentstopalignsconsiderroughreallyawaresambitbihiranakakatakotlcdkotseisinakripisyobansagawaduwende