Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "additionally"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

3. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

4. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

5. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

6. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

7. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

8. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

Random Sentences

1.

2. Tumingin siya sa akin, waring may nais siyang ipahiwatig.

3. Kumirot ang dibdib ko sa naisip.

4. Omelettes are a popular choice for those following a low-carb or high-protein diet.

5. May pitong araw sa isang linggo.

6. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

7. Ang nagliliyab na araw ay nagdulot ng matinding init sa buong bayan.

8. Ang paggamit ng droga ay maaaring magdulot ng mga epekto sa pag-iisip, emosyon, at pisikal na kalusugan ng isang tao.

9. Beyoncé is a highly acclaimed singer, songwriter, and actress known for her powerful performances and chart-topping hits.

10. Marahil ay malamig ang klima sa bundok sa panahon ngayon.

11. Cutting corners in your exercise routine can lead to injuries or poor results.

12. Electric cars have lower fuel costs than gasoline-powered cars since electricity is generally cheaper than gasoline.

13. Coping strategies such as deep breathing, meditation, or exercise can help manage feelings of frustration.

14. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

15. The widespread use of the telephone has had a profound impact on society

16. My grandma called me to wish me a happy birthday.

17. Kapag lulong ka sa droga, mawawala ang kinabukasan mo.

18. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

19. Gusto naming makita uli si Baby Janna eh. si Maico.

20. Verified accounts on Twitter have a blue checkmark, indicating that they belong to public figures, celebrities, or notable organizations.

21. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

22. Habang naglalakad ako sa dalampasigan, natatanaw ko ang malalaking alon na dumadampi sa baybayin.

23. Kinilig ako pero di ko pinahalata, whatever.

24. Ikaw ang bumitaw! hila-agawan ang ginagawa namin.

25. Hindi siya makatulog dahil sa kati ng bungang-araw.

26. Jeg er nødt til at skynde mig, ellers kommer jeg for sent. (I have to hurry, otherwise I'll be late.)

27. Masyado akong matalino para kay Kenji.

28. Ginagamit ang salitang "waring" upang ipahiwatig ang isang hinuha o tila isang bagay na maaaring totoo, ngunit hindi pa tiyak.

29. I know I should have gone to the dentist sooner, but better late than never.

30. Some oscilloscopes have built-in signal generators for testing and calibration purposes.

31. Pinili niyang magtungo palayo sa gulo upang makahanap ng katahimikan.

32. Psss. napatignin ako kay Maico. Naka-smirk siya.

33. A lot of money was donated to the charity, making a significant impact.

34. Nasa likod ng aking bahay, natatanaw ko ang bukid na puno ng sariwang mga halaman.

35. Ang "sa ganang iyo" ay ginagamit upang ipakita ang pansariling pananaw o opinyon ng isang tao sa isang partikular na isyu o sitwasyon.

36. Dadalo si Trina sa workshop sa Oktubre

37. Nagtaas na nang pamasahe ang trycycle.

38. Hinawakan ko yun yung kamay niya tapos nag smile at nag nod.

39. Mahilig maglaro ng video games si Marvin.

40. Limitations can be challenging, but they can also inspire creativity and innovation.

41. Mi esposo me llevó a cenar en un restaurante elegante para el Día de los Enamorados.

42. Ang gobyerno ay naglaan ng tulong para sa mga apektado ng tagtuyot.

43. Money has value because people trust that it can be used to purchase goods and services.

44. Banyak pemilik kucing di Indonesia juga menjaga kebersihan kandang atau tempat tinggal kucing mereka.

45. The culprit who stole the purse was caught on camera and identified by the victim.

46. Emphasis can be used to highlight a person's strengths and abilities.

47. Saan ang punta mo? nakapikit pa ng bahagya si Maico.

48. ¿Quieres que le agregue un poco de picante a tu comida?

49. Pumupunta siya sa Amerika taun-taon.

50. Facebook Memories feature reminds users of posts, photos, and milestones from previous years.

Similar Words

Additionally,

Recent Searches

pinaladauthoradditionallyposporonaapektuhancasamarienakikilalangdiseasesyouthkaninumannewspaperspinatiramoviestv-showsnagtawanannagdarasalmaligayasisipainhinilasisidlanhanapinkasalukuyanriyanbutassnanakatitigpagkakapagsalitawashingtonikukumparakamotegamemaibigayibinaonmagkabilangkabosesfredinilalabasflamencolipadcrosseditorpagbebentatanggalintiniklingpogiiniinomlakadipatuloykabibinaglaromalagoanayfamenageespadahanetotanghaliinakalangwalismahabolmahahanaytig-bebentekinalilibingantumatanglawnaibibigay1929meaningbabemisyunerongmurang-murapagsusulattaongmetodersumayascottishproducirdoonwordskalakingtiningnanspeechessasayawinloriginangkumakainteleviewingaabotsurroundingsearningresearch:lumalangoychambersdoingsulingandeletingdustpanburdenpasliteksaytedmaalogsinagotremainmagbasabinentahannagsalitastrategiesfurysabogmagkaibiganhdtvvitaminmagpakasalstatingsasagutinhacernapipilitanprobablementenagmistulanggagamitanghelmaliitpamilyapinaulananpeksmannakilalademocraticyatamagdamagexpeditedhastacelularesnakangisinagtrabahoseewatawatfilmmalezapakistannakikiakarununganseguridadkumatoknatuloytapatvalleymilyongproudbinibilangtherapeuticssong-writingconsistbayanicultivationibilisinapaktmicamagtanimkalanipagamotbumabanangingilidfrogstandsang-ayonpagtawamajorelenanenaitinatapatbundokpatienceiconicmatapobrengdeliciosapaulit-ulitkarangalanambisyosangpasyentekasamaangjudicialpakainsurgerygataspagngitipagkamanghaselebrasyondalawaikinalulungkotbatokcrecermasaksihanibinilimagbayadreaksiyonritocolouriniangatmagdamaganawaretakes