Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "mind"

1. If you're trying to get me to change my mind, you're barking up the wrong tree.

2. It can be helpful to create an outline or a mind map to organize your thoughts

3. Keep in mind that making money online takes time, effort, and patience

4. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

Random Sentences

1. Hinde naman ako galit eh.

2. Smoking is prohibited in many public places and workplaces to protect non-smokers from secondhand smoke exposure.

3. Mathematical formulas and equations are used to express relationships and patterns.

4. Mathematics is the study of numbers, quantities, and shapes.

5. Sumakay kami ng kotse at nagpunta ng mall.

6. Pakitimpla mo ng kape ang bisita.

7. Ang taong lulong sa droga ay parang nasa bangin na patuloy na bumababa hanggang sa wala na siyang mahawakan.

8. Investing in the stock market can be a form of passive income and a way to grow wealth over time.

9. Disyembre ang paborito kong buwan.

10. Dahil sa pandidiri ay nilayuan niya ito pero ang pulubi ay humabol at nagmakaawa.

11. My husband surprised me with a trip for my birthday, and I couldn't be happier.

12. Samantala sa malamig na klima, nag-aalaga siya ng mga halaman sa loob ng bahay.

13. Bantulot niyang binawi ang balde, nakatingin pa rin kay Ogor.

14. Elije el lugar adecuado para plantar tu maíz

15. Pwede mo ba akong tulungan?

16. Magandang-maganda ang pelikula.

17. Pito silang magkakapatid.

18. Magtanim tayo ng kabutihan sa lupa upang anihin natin sa langit.

19. Si Aguinaldo ay nahuli ng mga Amerikano noong 1901 sa Palanan, Isabela.

20. Naglalaro kami ng 4 pics 1 word sa cellphone.

21. The information might be outdated, so take it with a grain of salt and check for more recent sources.

22. Limitations can impact one's career, relationships, and overall quality of life.

23. Binigyan niya ako ng isang dosenang rosas.

24. Can you please stop beating around the bush and just tell me what you really mean?

25. Chester A. Arthur, the twenty-first president of the United States, served from 1881 to 1885 and signed the Pendleton Civil Service Reform Act.

26. Scissors should be kept sharp to ensure clean and precise cuts.

27. Isa sa mga paboritong routine ni Carlos Yulo ay ang floor exercise, kung saan madalas siyang mag-uwi ng medalya.

28. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

29. Ang purgatoryo ay nagpapakita ng kahalagahan ng paglilinis at pag-aayos ng kaluluwa bago pumasok sa langit.

30. The company introduced a new line of lightweight laptops aimed at students and professionals on the go.

31. The value of cryptocurrency can fluctuate rapidly due to market forces.

32. Nasarapan ako sa luto ni Chef Josh.

33. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

34. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

35. Ang pagkapanalo ng koponan ay siyang ikinagagalak ng lahat ng sumuporta sa kanila.

36. Tahimik na nanangis si Aling Rosa at laking pagsisisi dahil tumalab ang kanyang sinabi sa anak.

37. They offer rewards and cashback programs for using their credit card.

38. Pakibigay ng oras para makapagpahinga ang iyong sarili.

39. Supportive care, such as blood transfusions and antibiotics, may be necessary to manage complications of leukemia treatment.

40. Exercise can be tough, but remember: no pain, no gain.

41. Las vacaciones son una época para compartir regalos y mostrar gratitud.

42.

43. La pobreza afecta no solo a las personas, sino también a las comunidades enteras.

44. La comida tailandesa es famosa por su sabor picante.

45. We have finished our shopping.

46. Nahuli na kahapon ang nagnakaw ng kalabaw ni Mang Arturo.

47. Tumawa siya. Thank you Jackz! See ya! Bye! Mwuaaahh!!

48. Hello love birds! bati ko sa kanila nang makalapit ako.

49. Hindi nga ba't meron din daw siyang mga pakpak tulad nila.

50. Nagulat si Mang Kandoy sapagkat ang kulay ng dugo ng tigre ay abo.

Similar Words

sumindilumindolMindanaonaghuhumindigtumindigmind:

Recent Searches

conectadosmindcreatinggeneratemethodssparktipidlihimnabitawantirahanpamilihang-bayanflamenconaninirahantinungoevolverosassimonnanaypaladdaysdumilatsalbahedyippaidnatitirabayangtsssmayamanseriousamokinumutaninstitucionesaftermartialkamakailansinimulankanikanilangdistancianagbanggaanemocionesoffersharmainedeathdisenyongtinahaksinalondonpag-aralinpasyentefionabroadcastlongnananaghilibatokbisikletaduripamasahenaglalarodistansyabalancesisinasamanaglalatangmakakatakasperpektodiyaryoculpritclientesknowkrusbagonagbantaynatingbarabasdilimplatformsdeteriorateinalalayantusindvisrichbubongmotionreallynagkakakaintsonggoberkeleygraduallyplatformenviarkasingditobehalfpaliparindennepag-aanietopagkabalotmandirigmangpariconnectingjoelalakenginaapiipakitacramethingwonderkagabikristopinsankarnabalnasisiyahanpangungusapsumibolsoftwaremangyariinaabotcuriousnapakahabapanigpaketenakapaligidmatangkadsumindiibinalitangritafuelmaskaranyantamisfulfillingestudionagpuntahantawadisinalangunconventionalthoughtsspreadwriteboyfriendlamesaadangtomorrowscientificsumasagotbisitakindleadvertisingbutisinumankonsyertodaangbestfrienddyosamakisuyotanyagtumubongnakalipasregulering,nearofrecensalarinmatapobrenginterests,masyadongrealnahigaspecialedukasyonnobodypinangalanangbagkusorderinbinitiwanngumitimarahilkailanpagkapasanganapanatilihinpagkakataonnagpasamatasasabongpeppykinsetinaasanwakasnakakatandanawawalaskykitang-kitagagambamakikinigninyobinatakuwakexcusepantalongkumaen