Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "hugis"

1. Hugis katawan ng nakahigang babae ang bundok makiling.

2. Ito'y hugis-ulo ng tao at napapalibutan ng mata.

3. Nakuhang muli ang gong at nagkaroon pa ng punong may matamis na bungang hugis kampana ang mga taong-bayan.

4. Rektanggulo ang hugis ng mesa namin.

Random Sentences

1. Opo. Iiwasan ko po si Anthony. putol ko sa sinasabi niya.

2. She donated a significant amount to a charitable organization for cancer research.

3. Retweeting is a feature that allows users to share others' tweets with their own followers.

4. Ikinuwento niya ang nangyari kay Aling Pising.

5. Maraming alagang kambing si Mary.

6. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

7. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

8. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

9. At have en træningsmakker eller træningsgruppe kan hjælpe med at øge motivationen og fastholde en regelmæssig træningsrutine.

10. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

11. At noon, higit kailanman, naging hamak sila sa pagtingin ng lahat.

12. Este aderezo tiene un sabor picante y cítrico que lo hace delicioso.

13. Walang nakapakinig sa panaghoy ng matandang naglalakad sa lansangan.

14. Pumunta ako sa Iloilo noong tag-araw.

15. El invierno es la estación más fría del año.

16. Una dieta equilibrada y saludable puede ayudar a prevenir enfermedades crónicas.

17. Bigla ang pagbabago ng anyo ni Magda at Damaso.

18. Women have been subject to violence and abuse, including domestic violence and sexual assault.

19. Sa kabila nito, nanatili siyang aktibo sa politika ng Pilipinas pagkatapos ng pananakop.

20. Ang gubat ay puno ng iba't ibang magaganda, makukulay, at mababangong mga halamang namumulaklak.

21. Hinila niya ako papalapit sa kanya.

22. Ang mommy ko ay masipag.

23. Some critics argue that television has a negative impact on children, as it can lead to decreased attention spans and a lack of physical activity

24. Ilan ang batang naglalaro sa labas?

25. Nag-uumigting ang kanyang mga ugat

26. Laganap ang paggamit ng social media sa kabataan ngayon.

27. Elektronik kan hjælpe med at forbedre miljøbeskyttelse og bæredygtighed.

28. Malapit lang pala bahay niyo eh. akala ko naman malayo!

29. La creatividad puede ayudar a solucionar problemas de manera más efectiva.

30. Pneumonia can be caused by bacteria, viruses, or fungi.

31. Our transport systems-diesel-run railways, steamships, motor vehicles, and aeroplanes-all constantly need natural fuel to keep on moving

32. Les maladies cardiaques, le cancer et le diabète sont des problèmes de santé courants dans de nombreux pays.

33. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

34. Les examens et les tests sont des évaluations importantes pour les étudiants.

35. Ang saranggola ay gawa sa papel, kawayan, at plastik.

36. In 1905, Einstein published a series of papers that established the foundations of modern physics and earned him worldwide recognition.

37. Sa pamamagitan ng malalim na paghinga at pagsasanay ng pagmameditasyon, ang aking stress ay unti-unti nang napawi.

38. Medarbejdere kan skifte karriere når som helst i deres liv.

39. Another area of technological advancement that has had a major impact on society is transportation

40. Ano ang inireseta ng doktor mo sa iyo?

41. Hindi ko alam kung bakit.. pero naiyak na lang ako.

42. Tantangan hidup dapat menjadi kesempatan untuk memperluas batasan diri dan mencapai potensi yang lebih besar.

43. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

44. Mahalagang igalang ang kalayaan ng ibang tao sa pagpapasiya ng kanilang mga sariling buhay.

45. Occupational safety and health regulations are in place to protect workers from physical harm in the workplace.

46. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

47. Det er vigtigt at huske heltenes bedrifter og lære af dem.

48. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

49. Nang mabangga ang kotse, kumaripas ang driver para umiwas sa responsibilidad.

50. The TikTok algorithm uses artificial intelligence to suggest videos to users based on their interests and behavior.

Similar Words

hugis-ulo

Recent Searches

boholayokohugisartistssonidocoalsumuothetoninongrosellemataposplasamalezarevolucionadonakitanakakagalingnakakapagpatibaynagpapaniwalanakakunot-noongpagbabagong-anyobrucehumayomalapitbridepamimilhinsolidifyhusayhumblepinag-usapanjudicialpinamalagimumuntingnagcurvecultivaiintayinnapipilitanalbularyoglobalisasyonmakangitinakatiranginspirasyonpapagalitankalayaankatutubonakatuwaangkongresointensidadumagawpamumunowatawatkomedortotoongsasakyantangeksibiniliencuestastitanalakistrategiesnagwikangdescargarsunud-sunodpinaulanannamilipitmadadalakasawiang-paladhinilakalaroendeligbinilitalinomakisuyobinatipahirammananaoggymreynadustpanguidancebutasturoniyongcoughingisipankainanitinulospampagandabantulothinanapmahigittinapayaudiencehinigitpresleykriskapabalanglagunazoothankaddictionvelstandisasabadpunung-punokonglumbaynagulatmembersbumabahabingbingdaladalasinkresumenumutangpalagiattractiveinomskypemaunawaanitinaponbagkustahananisippanayleftpaskoamparomakisigtuwingpaperconditioningfigurelimitmichaelletmind:actingfertilizerabidisappointlargerencounterhydelmegetnerofanstilapaamuchosnaggingintroductiondividesbabaikawlightsconsiderarcoachingnaroonwelltitigilnangangalitiloiloeducationalbalangcebukilosuelospeedbawatdinanaspresencenaturalhierbasbalitabangkokinalalagyannatitiramalabonapaplastikantodasnawalanasuklamsinisinapatingalafaulthinampasjoecurtainsbook,mayamayaseenfilmmahihirapmanghikayatdeliciosanasiyahankumakantanapapahintonumerososnakabawikina