Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "hugis"

1. Hugis katawan ng nakahigang babae ang bundok makiling.

2. Ito'y hugis-ulo ng tao at napapalibutan ng mata.

3. Nakuhang muli ang gong at nagkaroon pa ng punong may matamis na bungang hugis kampana ang mga taong-bayan.

4. Rektanggulo ang hugis ng mesa namin.

Random Sentences

1. Omelettes are a popular choice for those following a low-carb or high-protein diet.

2. Mapapa sana-all ka na lang.

3. Saan nagtatrabaho si Roland?

4. Wala yun. Di ko nga naisip na makakatulong. aniya.

5. Analog oscilloscopes use cathode ray tubes (CRTs) to display waveforms.

6. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

7.

8. Magkahawak kamay silang namasyal sa gubat ng magagandang halaman na ang buwan at mga bituin ang tumatanglaw sa kanilang dinadaanan.

9. There are a lot of opportunities to learn and grow in life.

10. The child was too young to receive the pneumonia vaccine and needed to be protected from exposure.

11. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

12. I'm sorry, I didn't see your name tag. May I know your name?

13. The sports center offers a variety of activities, from swimming to tennis.

14. At være transkønnet kan være en del af ens identitet, men det definerer ikke hele personen.

15. Anong oras mo gustong umalis ng bahay?

16. Magandang umaga Mrs. Cruz

17. She admired the way her grandmother handled difficult situations with grace.

18. Hindi ko kinuha ang inyong pitaka.

19. She carefully layered the cake with alternating flavors of chocolate and vanilla.

20. Nagising ako sa marahang pagtayo ni Maico.

21. The Great Wall of China is an impressive wonder of engineering and history.

22. Las plantas perennes viven durante varios años, renovando sus hojas y flores de forma periódica.

23. Kailan ka libre para sa pulong?

24. Lumakad sa kalye ang mga kabataan nang limahan.

25. Mange mennesker deltager i påsketjenester i kirkerne i løbet af Holy Week.

26. Twitter has a set of rules and policies to govern user behavior, including guidelines against hate speech, harassment, and misinformation.

27. The acquired assets will give the company a competitive edge.

28. Les personnes âgées peuvent bénéficier d'un régime alimentaire équilibré pour maintenir leur santé.

29. La creatividad es esencial para el progreso y el avance en cualquier campo de la vida.

30. At blive kvinde handler også om at lære at håndtere livets udfordringer og modgang.

31. He has fixed the computer.

32. At forfølge vores drømme kan kræve mod og beslutsomhed.

33. Nagbabaga ang talakayan sa klase habang nagtatalo ang mga mag-aaral tungkol sa isyu.

34. Sa takot ng mga tao sa pagsalakay ng mga tulisan, ibinaon nila ang gong sa isang lugar na malapit sa gubat.

35. In the early days, telephones were connected to a central switchboard, which connected calls manually

36. Kung walang tiyaga, walang nilaga.

37. Det er en dejlig følelse at være forelsket. (It's a wonderful feeling to be in love.)

38. Que tengas un buen viaje

39. Ang pagbisita sa magagandang tanawin ng Pilipinas ay ikinagagalak ng mga turista.

40. Inakalang magugustuhan ng lahat ang ideya niya, pero tinanggihan ito.

41. Det er vigtigt at tage hensyn til ens egne begrænsninger og sundhedstilstand, når man vælger en form for motion.

42. Hindi ko man masabi sa iyo nang harapan, pero crush kita nang sobra-sobra.

43. Einstein was known for his sense of humor and his love of sailing.

44. Hala, gusto mo tissue? Sorry ah, hindi ko alam.

45. May problema ba? tanong niya.

46. All these years, I have been surrounded by people who believe in me.

47. Her lightweight suitcase allowed her to pack everything she needed for the weekend getaway without exceeding the airline's weight limit.

48. He is taking a photography class.

49. Close kasi kayo ni Lory. ngumiti sya na sobrang saya.

50. Sa matinding sikat ng araw, tila sya ang mandirigmang sugatan, ngunit matatag na nakatindig sa pinagwagihang larangan.

Similar Words

hugis-ulo

Recent Searches

hugismadamiwordbinawibitiwanmenoshisasinmabilisbernardosearchgracereservationlaylaypumuntaelectionsboracayanimqualitycasesexpectationssharehimutokiyosiyang-siyaestablishedsalapiprocessmenucharitablepersonsdiindoktortheirmamayagooglebagonglibohinanapitinaastumatawaarawpopularkutodpanindaadmiredpinatirafitnesswidelynasiyahanduladagaschedulehumabolbalik-tanawspansmamidisyempredeletingthereforebansaprogresssolidifyinventionnauwilagisumasakaybinibilangasiaticlinggo-linggootherskasalgayunpamanpinagawanananalongtaga-nayonmagkakagustonakakunot-noongnangahasmakapalagnananaginipmalakihunibakasyonsimbahasiksikaninabutantv-showsmedicaltig-bebeintepakukuluanpeksmanpaninigasmataaasiyongarabiaandreapagsusulitnagpasaniikutanconvey,silamatayogpatiencepersonsnobpaskokalongkapelaryngitismag-asawangtelevisedmakaangalbinabaanchambersdemocraticitakmajoratagiliranasodownsofapartlockdowncontinuesuniqueskillfaceipihitformpangangatawankagabiaidunosworkingninadogsisatumatawadmalapalasyokomunikasyonkasamang18thedwinmedisinasalubongcornersecarsepostagaw-buhayhappenedamparobagodumatingnapilitanisinaratitowalangbataytulangunconstitutionaldalawangpagbatifollowingbeingimprovemeanlashoweverkonsentrasyonkusinerolumilipadmagbalikmatustusanpagkabiglabrancher,nagsunuranpuedelatermalapitnakauwih-hoynandayakamotedahan-dahannahihiyangpagtangisnataposnaghihirappaglingonpinapakingganmagagamitvaccinesmarketing:kulaypamimilhingkasalananbumilituladsipa