Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "nakakatawa"

1. Anong nakakatawa? sabay naming tinanong ni Sara

2. Nakakatawa? mataray na tanong ko sa kanya.

3. Natawa sya, Nakakatawa ka talaga. haha!

Random Sentences

1. Sa sobrang pagod, nagawa niyang paglimot sa mga pangyayari ng nakaraang araw.

2. Binibigyan niya ng halaga ang bawat oras na pinagsisikapan niya upang maging mabuting ina.

3. Hinanap nito si Bereti noon din.

4. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

5. Hiram muna ako ng libro na iyon bago ko desisyunang bilhin ito.

6. The United States is the world's largest economy and a global economic superpower.

7. Anak, iwasan mo si Don Segundo, baka ikaw ay mapahamak, pagpapaalaala ng nangangambang ina.

8. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

9. You need to pull yourself together and face the reality of the situation.

10. Dalam menghadapi tantangan, penting untuk memiliki dukungan sosial dan lingkungan yang positif.

11. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

12. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

13. La obra de Leonardo da Vinci es considerada una de las más importantes del Renacimiento.

14. Hindi dapat supilin ng mga magulang ang mga pangarap ng kanilang mga anak.

15. La rotación de cultivos es una práctica agrícola que ayuda a mantener la salud del suelo.

16. Nagtatrabaho ako sa Student Center.

17. Sa isang malakas na bagyo, hindi ko na nakita ang aking mga kasama dahil sa sobrang pagdidilim ng paningin ko.

18. Das Gewissen kann uns helfen, moralische und ethische Fragen zu beantworten.

19. Foreclosed properties may have liens or other encumbrances, which can complicate the purchase process.

20. Tanging edukasyon lamang ang pag-asa nating mahihirap.

21. The team's colors are purple and gold, and they play their home games at the Staples Center.

22. Elektronikken i en bil kan hjælpe med at forbedre kørsel og sikkerhed.

23. Cuídate mucho en el camino, maneja con precaución y no te distraigas.

24. Después de estudiar el examen, estoy segura de que lo haré bien.

25. Mag-aaral ako sa unibersidad sa susunod na taon.

26. Baby fever is a term often used to describe the intense longing or desire to have a baby.

27. Nalaman ito ni Venus at binigyan ng pagsubok sina Psyche at Cupid na nalagpasan naman nila at nagsama sila nang matiwasay.

28. L'entourage et le soutien des proches peuvent également être une source de motivation.

29. Dahil sa maayos na pamamahala, yumabong ang ekonomiya ng bansa.

30. The culprit responsible for the car accident was found to be driving under the influence.

31. Black Panther is the king of Wakanda and possesses enhanced strength, agility, and a suit made of vibranium.

32. Me da miedo pensar en lo desconocido, pero al final, "que sera, sera."

33. Agad naman na ngpunta si Aling Edna sa bahay nila na daladala ang parte nila sa napaghatian na gulay at bigas.

34. Sa mga malulubhang kaso, kailangan ng pagpapakonsulta sa espesyalista na dentista.

35. Banyak orang Indonesia yang mengajarkan doa sejak usia dini, sebagai salah satu nilai-nilai agama dan moral.

36. At være bevidst om vores handlinger og beslutninger kan hjælpe os med at undgå at skade andre og os selv.

37. Mahirap makita ang liwanag sa gitna ng mailap na kadiliman.

38. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

39. El equipo de recolección mecánico es muy eficiente para cosechar grandes extensiones de tierra.

40. Nasa ilalim ng mesa ang payong.

41. Nogle helte er kendte for deres modige handlinger under krig.

42. Nang magkasalpukan ang dalawang sasakyan, aksidente niyang naipit ang kanyang kamay sa pinto.

43. Hindi niya gustong maging nag-iisa sa buhay.

44. Ngunit wala siyang nararamdaman sakit.

45. They clean the house on weekends.

46. Hala, gusto mo tissue? Sorry ah, hindi ko alam.

47. Ang tahanan ng mga ibon sa tabi ng ilog ay mayabong at nagbibigay ng malasakit sa kalikasan.

48. Aba'y lintek na babaeng ito! Ang langis mo! Paano na ako magugustuhan ni Pedro nyan! ani ni Ipong sabay hawi ng buhok.

49. Has he spoken with the client yet?

50. Nagpatupad ang mga pulis ng checkpoint upang mahuli ang mga posibleng salarin.

Recent Searches

nakakatawasasabihinmalamangmagkasinggandapalengkebuwayakaykayaberegningermadilimnagtatakadatapwatmabibingipotaenaparisukathumalosalaminteknologimaghapongpauwipaamaliksikapataganbuhokbyggethmmmmaalwangtatawaganpunong-punomaliitandrewlalakadpamilihang-bayanlagaslasmarketplacesfourpinaladmahinangipinculpritmagpa-paskobinibinichumochosmagingpagmasdankumalatkalabawadverselybasketballkanilakitabinasadoonmagpa-ospitalengkantadanagmamadalitagaakinmamalascongratswhilepwedengdurianpasankaniyakumidlatsimplengkwenta-kwentabringkolehiyobitbitnawawalaseryosongmatandanapilicommander-in-chiefbihasamababangisknowspamilyatablemaghaponpundidokarwahengangheliyannahintakutansolidifybagamakalayaanlumampasnyamasipaglabanartificialnaglalabamanatilisang-ayoniba-ibangsabermagandapleasenatandaanpang-araw-arawbulaklakgirlbayarancallunawarinaliligomaingataywanmabihisanhinahanapbabaengpalaisipansinulidnumerosasrebolusyonmedya-agwamarketingkasingprobablementepaghahanapbumagsakneronilapitanmagkanobukaskaugnayansagabalmiyerkulespatiiskedyulpuedesnaghihinagpisnapapansinnagliliwanagmatchingnaibibigayutilizamaglinissiyang-siyamalihismaglalaronatinagdinalagooglegawanakitulogtinanggappunong-kahoymahigpitkahaponpadabogpalibhasapaladnangahasnagdiretsosawsawanviewspagkamanghapahahanapzoomagawalubospagkataopanginoonnakakuhapagpilinararapatbalitalalotayomagnakawpaglalabaabenagawainhawakantsaapramiskasamaadvancenaglaonsesamemakahihigitsinunud-ssunodpagkakatayocigarettesnasuklammatsingcongressallowinggospelhangaringdoingfalljanelalabhan