Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "audio-visually"

1. Businesses and brands utilize Instagram to promote products and services through visually appealing posts.

2. The website's design is sleek and modern, making it visually appealing to users.

3. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

4. Twitter has implemented features like live video streaming, Twitter Spaces (audio chat rooms), and fleets (disappearing tweets).

Random Sentences

1. Medyo napalakas ang pag kakauntog nya sa pader.

2. Tumango lang ako. Wala ako sa mood na magsalita.

3. La fotosíntesis es el proceso mediante el cual las plantas convierten la luz solar en energía.

4. Sa anong tela gawa ang T-shirt?

5. Las serpientes mudan su piel periódicamente para permitir su crecimiento y eliminar parásitos.

6. TikTok has been banned in some countries over concerns about national security and censorship.

7. Saan siya nagpa-photocopy ng report?

8. Amazon's Kindle e-reader is a popular device for reading e-books.

9. May isang umaga na tayo'y magsasama.

10. Tumango siya tapos dumiretso na sa kwarto niya.

11. Nakaramdam ako ng sakit kaya hinugot ko ang aking kamay upang pumigil.

12. Representatives are accountable to their constituents, who have the power to elect or remove them from office through elections.

13. Tumayo yung limang babae at lumapit kay Kerb.

14. Anong oras mo ako ihahatid sa airport?

15. Nasa Cebu si Trina sa Disyempre?

16. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

17. Hindi nawawala ang halaga ng panitikan sa pagpapalaganap ng kultura at kaalaman.

18. Angelina Jolie is an acclaimed actress known for her roles in films like "Tomb Raider" and "Maleficent."

19. Sinuman sa kaharian ay walang makapagbigay ng lunas.

20. Hindi ko alam kung kailan magiging tamang oras, pero sana pwede ba kita makilala?

21. Ang Mabini Colleges sa Daet, Camarines Norte ay isa sa mga pinakamalalaking paaralan sa lugar.

22. Mabuti na lang at hindi ako nauntog sa bubong ng dyip.

23. Kucing juga dikenal sebagai pembasmi tikus dan serangga di rumah atau tempat tinggal.

24. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

25. Tibig ng ligaya ang puso ng mag-asawa sa pag kakaroon ng maipagmamalaking anak.

26. A penny saved is a penny earned.

27. LeBron James is a professional basketball player widely regarded as one of the greatest athletes of all time.

28. They have been dancing for hours.

29. Lumitaw ang kagandahan ni Marie matapos syang mabihisan.

30. Huwag daw siyang makikipagbabag.

31. The restaurant was full, and therefore we had to wait for a table.

32. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

33. Ang tubig-ulan ay maaaring magdulot ng mga masaganang pananim at halaman dahil sa pagtustos sa mga pangangailangan ng mga ito.

34. Some kings have been deposed or overthrown, such as King Louis XVI of France during the French Revolution.

35. Inalok ni Maria ng turon si Clara.

36. Ang mga paputok at pailaw ay karaniwang bahagi ng pagdiriwang ng Chinese New Year.

37. La paciencia nos da la fortaleza para seguir adelante.

38. Every cloud has a silver lining

39. Sa mga nagdaang taon, yumabong ang mga proyekto para sa kalikasan at kabuhayan ng mga tao.

40. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

41. Les écoles offrent des bourses pour aider les étudiants à payer leurs frais de scolarité.

42. Walang 'tayo' Maico. Kaya please lang iwan mo na ako.

43. The objective of football is to score goals by kicking the ball into the opposing team's net.

44. El cultivo de arroz requiere de un terreno inundado y condiciones climáticas específicas.

45. Pinakain ni Fia ang aso ng dog treats.

46. The stock market gained momentum after the announcement of the new product.

47. She learns new recipes from her grandmother.

48. Los Angeles is home to prestigious universities like UCLA and USC, attracting students from around the world.

49. Elektronisk udstyr kan hjælpe med at reducere energiforbrug og spare penge.

50. La seguridad en línea es importante para proteger la información personal y financiera.

Recent Searches

bilispookaudio-visuallyberkeleymatagpuankinauupuanorasanmahuhusayoftenformatprogrammingcomputeresimplengmultostudiedbitawanplannaiinggittominternetgamotpaulaeskwelahandagat-dagatannabahalamaalikabokinfinityshininghenrynaglutofeedbackmalasutlaownkawaljingjingmednyangsakimgayunmannamnamumulotbarrocofianapakatongiwinasiwaseksamenbrancher,nagstagepinag-aralanatinpara-paranggrowthkaysarapmagpaliwanagmarmaingtanyagpaakyatbarongtransparentkuwartabinabatibulatemarahasnatapostabanag-iisangarbularyoduguanhubad-baronasulyapangaslumahokmatalimnabigkascurtainsmakausapmaongdunmaskimarahilhariamparohumansignificantclimbednagsilabasanlargerglobalnamanrosastime,usaintroduceferrersumpunginpagsayadvirksomhedernananaginippinakamatabangnagpapasasakinikitakomunikasyonpagtutolpropensomakikitanaglahowalkie-talkienamumulaklaknagkakatipun-tiponlasonguugud-ugodpangyayarinagpabayadnagliwanagpamahalaanculturalnagsisigawkagipitanmagalangbeautyairportpinagbigyanhitabayawakelevatorkumalaspakakasalanpersonastennisgospelamericakarapatangdepartmentnagwalismagbabalanatitiyaklagnattig-bebeintenapilimagazinesmaskinerlalargaparusahanpigilanguerrerojeepneytandangbintanafriendkapagbinabarathanapinnaglabanagpasanfollowingmatutulognobodynakabaonlabinsiyamipatuloylagaslasasahanmoneylakadpalayocommercialmayabongnabiglaobservation,maidbisikletakaragatandiaper2001misteryotawapaggawaisuboplagasejecutankahusayanpinalayasenerobooksmaayosnariyansocialehverganangoutlineutilizarjenakaugnayankulangmatabangbinanggamaestromahirap