Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "support"

1. All these years, I have been blessed with the love and support of my family and friends.

2. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

3. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

4. Cancer patients may receive support from various healthcare professionals, such as oncologists, nurses, and social workers.

5. Dogs can provide emotional support and comfort to people with mental health conditions.

6. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

7. Fathers can be strong role models, providing guidance and support to their children.

8. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

9. Franklin Pierce, the fourteenth president of the United States, served from 1853 to 1857 and was known for his support of the Kansas-Nebraska Act, which contributed to the outbreak of the Civil War.

10. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

11. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

12. He set up a charitable trust to support young entrepreneurs.

13. He used TikTok to raise awareness about a social cause and mobilize support.

14. Hospitalization can have a significant impact on a patient's mental health, and emotional support may be needed during and after hospitalization.

15. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

16. I am absolutely grateful for all the support I received.

17. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

18. Lazada has partnered with government agencies and NGOs to provide aid and support during natural disasters and emergencies.

19. Many people work to earn money to support themselves and their families.

20. Quitting smoking can be challenging and may require support from healthcare professionals, family, and friends.

21. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

22. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

23. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

24. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

25. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

26. Trump's rhetoric and communication style were often unconventional and garnered both passionate support and strong opposition.

27. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

28. Users can like, react, or share posts on Facebook to show their engagement and support.

Random Sentences

1. Las plantas trepadoras, como las enredaderas, utilizan estructuras especiales para sujetarse y crecer en vertical.

2. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

3. Candi Borobudur di Yogyakarta adalah salah satu candi Buddha terbesar di dunia yang sangat terkenal.

4. Illegal drug traffic across the border has been a major concern for law enforcement.

5. Anung email address mo?

6. If you don't want me to spill the beans, you'd better tell me the truth.

7. Gumamit si Mario ng matibay na tali para sa kanyang saranggola.

8. Nagbabaga ang usapan ng mga opisyal sa harap ng media dahil sa kontrobersiya.

9. Inalagaan ng mag-asawa ang halaman at nang lumaki ay nagkabunga.

10. Masaya naman talaga sa lugar nila.

11. Maganda ang bansang Japan.

12. Ang tahanan ng mga ibon sa tabi ng ilog ay mayabong at nagbibigay ng malasakit sa kalikasan.

13. Ese vestido rojo te está llamando la atención.

14. Endelig er Danmark også kendt for sin høje grad af økologisk bæredygtighed

15. Sa ganang iyo, mahalaga pa ba ang kultura at tradisyon sa modernong panahon?

16. Ibinigay ko ang aking karanasan upang matulungan ang aking mga kababayan na nangangailangan ng tulong.

17. Reinforcement learning is a type of AI algorithm that learns through trial and error and receives feedback based on its actions.

18. May sisenta sentimos nang kumakalansing sa bulsa ng kutod niyang maong.

19. Nagitla ako nang biglang tumunog ang emergency alarm sa opisina.

20. Dadalawin ko ang aking mga alagang palaka sagot ng dalaga

21. Claro que sí, estoy dispuesto a aprender cosas nuevas.

22. Kings may have ceremonial duties, such as opening parliament or receiving foreign dignitaries.

23. Ang pagguhit ay isang mahusay na paraan upang ipakita ang iyong kreatibidad.

24. The football field is divided into two halves, with each team playing offense and defense alternately.

25. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

26. Ang bawat tao ay may natatanging abilidad na nagbibigay kahulugan sa kanilang buhay.

27. Ang illegal na droga ay mahigpit na ipinagbabawal sa kanilang lungsod.

28. Natutuhan ng mga mag-aaral ang talambuhay ni Heneral Luna at ang kanyang ambisyon para sa pagbabago ng bayan.

29. Tumagal ng tatlong oras ang kanyang operasyon.

30. Ang mga punong-kahoy ay kinikilala rin bilang mga tagapagligtas ng ating planeta dahil sa kanilang kakayahan sa pag-absorb ng carbon dioxide.

31. Narealize ko sa dakong huli na mahal ko pa rin ang aking ex.

32. Nanlilimahid ang mga bata sa daan.

33. Tinamaan ng lumilipad na bola ang bintana at ito’y nabasag.

34. Børn bør have adgang til uddannelse og sundhedsydelser uanset deres baggrund eller socioøkonomiske status.

35. Ang pagkakaroon ng malakas na lindol ay binulabog ang mga gusali at nagdulot ng takot sa mga tao.

36. Sa muling pagtataas ng tungkod ng matanda, lalong dumagundong ang mga kulog at tumalim ang mga kidlat.

37. Kanina sabi mo joke, ngayon example. Ano ba talaga?!

38. Waaa. Ikaw pala salarin kaya ayaw nya sa ospital!

39. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

40. Kung hindi ngayon, kailan pa?

41. Napagalitan si Juan dahil na-suway siya sa paglabag sa traffic rules.

42. The guilty verdict was handed down to the culprit in the embezzlement trial.

43. Ang mga NGO ay nag-aapuhap ng donasyon upang matulungan ang mga batang ulila.

44. Matapos magbabala ay itinaas ng matanda ang baston.

45. Ok ka lang? tanong niya bigla.

46. Nahulog ang bola sa dagat kaya lumangoy si Rico para kunin ito.

47. The acquired assets were key to the company's diversification strategy.

48. Wala naman sa palagay ko.

49. Masarap ang bawal.

50. Ang mga estudyante ay sumailalim sa isang pagpupulong upang magbahagi ng kanilang mga mungkahi sa paaralan.

Recent Searches

increasesupportguiltyinfluencereleasedtechnologiesdentistasumayaideadesarrollaronmeriendaheargiriskatagalanna-suwaybiyastwinklenasugatanmanunulatnagpatuloyhinamonpagkaangatworldjokesiksikandaysiikutanpansitconvey,itutuksonayonandres1928arbejderlookedallowingtindahanpaghangamatapossalu-saloboyguardapagkalungkotnagsisipag-uwianpalipat-lipatnakasahodbiologisasagutinpagtatanongnaglalaronagpapaniwalanamulatnaglipanangtemparaturanakatindignaabutanyoutube,mahinangnamataynaliwanaganflyvemaskinerimporformasuzettejuegospaghalikprodujonagdabogumiyakarbejdsstyrkemakasalanangnaiisippanapakakasalanpagguhitlagnatorkidyaspinansinrenacentistaautomatiskmagkanonavigationkaraniwangpaggawabanktirangnababalotmahigpitrobinhoodshadesnagniningningpaglayassurveyshinamakumokaynaghubadfollowinglandassampungtandangmatagumpayiba-ibangpoothuwagnaligawalongpresleymagnifytodasngisibandamatitigasituturomakinangninyocommunicategymkumatoknahihiloutilizarkumukulohomeszookatapatmataraykindsradioremainmakasarilinglettercalciumusoalaalainantaypanotresintoharmfulpopulationdaancondogracepupuntatextoavailableshowparusahancontestasinlatethenjudicialleobisigsubalitkablan1876boxevilevendigitalchecksnasundoduladividesipinaabshappenedmagkaroonprogramsnaunamemorybataclientetabareallyryaninternadeclarestreamingnagmamaktolnapatawagagam-agambumugahuertoamericanofficehapagcuidado,puntahan1990solidifydaratingmagworkstudyeconomicnakatirashopeepag-indaknakabibinging