Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "support"

1. All these years, I have been blessed with the love and support of my family and friends.

2. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

3. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

4. Cancer patients may receive support from various healthcare professionals, such as oncologists, nurses, and social workers.

5. Dogs can provide emotional support and comfort to people with mental health conditions.

6. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

7. Fathers can be strong role models, providing guidance and support to their children.

8. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

9. Franklin Pierce, the fourteenth president of the United States, served from 1853 to 1857 and was known for his support of the Kansas-Nebraska Act, which contributed to the outbreak of the Civil War.

10. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

11. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

12. He set up a charitable trust to support young entrepreneurs.

13. He used TikTok to raise awareness about a social cause and mobilize support.

14. Hospitalization can have a significant impact on a patient's mental health, and emotional support may be needed during and after hospitalization.

15. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

16. I am absolutely grateful for all the support I received.

17. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

18. Lazada has partnered with government agencies and NGOs to provide aid and support during natural disasters and emergencies.

19. Many people work to earn money to support themselves and their families.

20. Quitting smoking can be challenging and may require support from healthcare professionals, family, and friends.

21. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

22. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

23. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

24. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

25. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

26. Trump's rhetoric and communication style were often unconventional and garnered both passionate support and strong opposition.

27. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

28. Users can like, react, or share posts on Facebook to show their engagement and support.

Random Sentences

1. The two most common types of coffee beans are Arabica and Robusta.

2. Kumaripas ng takbo ang aso nang makita ang paparating na sasakyan.

3. Nagkapilat ako dahil malalim ang sugat ko.

4. Anong ginagawa mo?! mataray pang sabi nito.

5. Ang mga bata ay lumabas ng paaralan nang limahan.

6.

7. Te agradezco por estar siempre ahí para mí.

8. As your bright and tiny spark

9. Pinikit niya ang mata upang namnamin ang sarap ng tsokolate.

10. Disse inkluderer terapi, rådgivning og støttegrupper.

11. May sisenta sentimos nang kumakalansing sa bulsa ng kutod niyang maong.

12. Andre helte arbejder hver dag for at gøre en forskel på en mere stille måde.

13. Ibinigay ng mga magulang ko ang lahat ng kanilang sakripisyo upang maibigay ang magandang buhay sa amin.

14. "You can't teach an old dog new tricks."

15. La conciencia nos ayuda a entender el impacto de nuestras decisiones en los demás y en el mundo.

16. Cars, airplanes, and trains have made it possible for people to travel great distances in a relatively short amount of time

17. Higupin ng basang tuwalya ang tubig sa mesa.

18. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

19. Ano ang isinusuot ng mga estudyante?

20. Franklin Pierce, the fourteenth president of the United States, served from 1853 to 1857 and was known for his support of the Kansas-Nebraska Act, which contributed to the outbreak of the Civil War.

21. Naging masaya naman ang dalawa kahit may kondisyon si Cupid na hindi maaaring makita ang kaniyang mukha.

22. Gigising ako mamayang tanghali.

23. I admire the perseverance of those who overcome adversity.

24. He starred in a number of films in the 1950s and 1960s, including Love Me Tender, Jailhouse Rock and Viva Las Vegas

25. "Mahirap magtiis, pero mas mahirap ang walang tiis" ay isang bukambibig na nagpapahiwatig ng halaga ng pagtitiis sa mga pagsubok at paghihirap sa buhay.

26. Hugh Jackman is best known for his portrayal of Wolverine in the "X-Men" film series and his Tony Award-winning performance in the musical "The Boy from Oz."

27. The player who has the ball is called the "offensive player," and the player guarding him is called the "defensive player."

28. Saka dalawang hotdog na rin Miss. si Maico.

29. Nasawi ang drayber ng isang kotse.

30. Kumaripas ng lakad ang matanda nang bumilis ang ulan.

31. Pakibigay sa amin ang detalyeng kailangan para maayos naming magawa ang proyekto.

32. Sa gitna ng dilim, nagbabaga ang mga uling sa apoy, nagbibigay-liwanag sa paligid.

33. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

34. Kapag mayroong mga hindi inaasahang pangyayari sa buhay, madalas na nagkakaroon ng agam-agam sa mga tao.

35. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

36. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

37. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

38. Los héroes son capaces de tomar decisiones difíciles y hacer sacrificios personales en beneficio de los demás.

39. Makikipag-dueto si Maria kay Juan.

40. This is a tough situation, but we'll get through it if we hang in there.

41. Einstein was born in Ulm, Germany in 1879 and died in Princeton, New Jersey in 1955.

42. Conservation efforts, such as protecting natural habitats and endangered species, are critical to maintaining a healthy environment.

43. Nagkakamali tayo sapagkat tayo ay tao lamang.

44. Papuntang Calamba ang dilaw na bus.

45. Attractive packaging and expert publicity helped spread the addiction to smoking cigarettes even among the poorer sections of the people

46. The goal of investing is to earn a return on investment, which is the profit or gain earned from an investment.

47. The detectives were investigating the crime scene to identify the culprit.

48. Unfortunately, Lee's life was cut short when he died in 1973 at the age of 32

49. Palibhasa ay may kakaibang pagtingin sa mga bagay dahil sa kanyang malawak na kaalaman at pag-unawa.

50. Ang pagpili ng mga kasuotan para sa kasal ay dapat ayon sa tema ng kasal.

Recent Searches

rawkapilingimpacteddevelopmentsupportmitigatestreamingconservatoriosnabitawandadalhinnyenumerososvedvarendeherramientasannadiferentesnalalabingsuccessdisposallucykundiablecigarettesmagkabilanganilakwebaetosyncarayagilitypointnakatayopresence,susulitadicionalesnatatakotkumaripasbalitasettingeditorpaaaddresstulisanuniversityhulihaninakalapakanta-kantangrevolucionadoadvertising,namumulotnakikiapagkagustonaiyakkalakio-orderperwisyorememberedmanagertiyacreatedollarrecibirtalinonangingilidfilmsbundokbilaomodernnawalangmanghulimaisfuehoteltotoongabundantevideospinamalagitatagalsagasaanfitnessnakapasapagsahodnaliwanaganaanhinhinawakan1973pinahalatafilmkalayaansalamangkeronagtrabahonagmamadalikapatawarankikitasabogpatiencebawatnewspapersnilalangvelfungerendeumagaminamasdannilayuanhinukaybiglangginugunitanagtitiismarketplaceskagandahagnakapagreklamoisinusuotnapasigawpunosunud-sunuranhumiwalaypronounnagreklamorebolusyontungawtumutubomagkaharapnakaririmarimnaliligohahahamasagananggumigisinglondonnagtataeinagawlumabaspumulotmagamotsakyansunud-sunodkoreaadvancementpagdiriwangpakistanhinalungkatmakisuyoiligtasmagsabisaangroceryutilizanmanonoodsarongmaibigaynuevosiikotrimasrieganiligawanmatapangkarangalanpagkatkasalcarlokriskabigongskyldesthroatself-defensekikovisttagaloghmmmpumatolhuwebesbateryaiskedyulinihandadumaanultimatelybatokpieceskadaratingtuwingmakisigshopeelamanipapaputolcapitalupuanlangkaysumusunoeffortsbalingbataybumahaindividualumingitdalawaywandettenangunoencounterfanshomework