Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "style"

1. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

2. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

3. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

4. Musk has faced controversy over his management style and behavior on social media.

5. The fashion designer showcased a series of collections, each with its own unique theme and style.

6. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

7. Trump's rhetoric and communication style were often unconventional and garnered both passionate support and strong opposition.

Random Sentences

1. Bawat umaga, ako'y bumabangong maaga para maglakad sa dalampasigan ng karagatan.

2. Kapag may mga hindi malinaw na plano sa buhay, maaaring magdulot ito ng agam-agam sa mga tao.

3. Leukemia can be acute or chronic, depending on how quickly the disease progresses.

4. Dedication is what separates those who dream from those who turn their dreams into reality.

5. Hinintay kong magsalita si Kuya Patrick sa kabilang linya.

6. She is not playing the guitar this afternoon.

7. Ayaw kong sumakay ng bus kung minsan.

8. Sa isang iglap ay nakalabas sa madilim na kulungan ang Buto.

9. Hinahangaan siya ng marami dahil sa kanyang pagiging mapagkumbaba kahit galing siya sa mababa na estado ng buhay.

10. I don't eat fast food often, but once in a blue moon, I'll treat myself to a burger and fries.

11. I heard that he's not trustworthy, so I take everything he says with a grain of salt.

12. Sa mga lugar na may tag-ulan, kadalasang mas madalas magkasakit ang mga tao dahil sa mas mabilis na pagkalat ng mga sakit sa panahon ng malakas na ulan.

13. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

14. Maglalaro ako ng tennis. Ikaw?

15. El uso de las redes sociales está en constante aumento.

16. Si Sarah ay mahusay sa pagtugtog ng gitara, datapwat hindi siya marunong mag-awit.

17. Napa wow na lang ako ng makita ko ang kanyang suot na bestida.

18. Ang mga botanista ay nagtatanim ng mga endemikong halaman sa mga pook kagubatan.

19. The Easter Island statues, known as Moai, are a mysterious wonder of ancient stone sculptures.

20. Dahil sa pagtatapos ng isang mahabang relasyon, siya ay puno ng lungkot at panghihinayang.

21. Nagmadali kaming maglakad papalapit kay Athena at Lucas

22. Sama-sama. - You're welcome.

23. Les enseignants doivent respecter les normes de sécurité en vigueur dans les écoles pour protéger les élèves.

24. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

25. Bakasyon ko na sa susunod na buwan.

26. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

27. Puwede kang magguhit ng mga larawan ng iyong pamilya at kaibigan upang ipakita ang pagmamahal sa kanila.

28. Sa kabila ng paghihinagpis, nagsikap ang mga residente na bumangon matapos ang trahedya.

29. En tung samvittighed kan nogle gange være et tegn på, at vi har brug for at revidere vores adfærd eller beslutninger.

30. It ain't over till the fat lady sings

31. No puedo creer que ya te vas, cuídate mucho y no te olvides de nosotros.

32. Sayang, jangan lupa untuk makan malam nanti. (Dear, don't forget to have dinner tonight.)

33. Buenos días amiga

34. The objective of hockey is to score goals by shooting the puck into the opposing team's net.

35. May himig pangungutya ang tinig ng pulis.

36. Nang magbabayad ako ng pinamili ko't kapain ko ang bulsa ko, e wala nang laman!

37. Samantala sa malayong lugar, nagmamasid siya ng mga bituin sa kalangitan.

38. Landet har en omfattende social sikkerhedsnet, der sikrer, at alle borgere har adgang til sundhedspleje, uddannelse og sociale ydelser

39. Ang paglapastangan sa mga relihiyosong simbolo ay labag sa mga patakaran ng paggalang sa iba.

40. Pinabulaanang muli ito ni Paniki.

41. Les médecins et les infirmières sont les professionnels de santé qui s'occupent des patients à l'hôpital.

42. Walang sinasabi ang mga ito, ngunit sa mga mata, sa galaw ng mga labi nababasa nya ang isinisigaw ng mga paslit.

43. Sí, claro, puedo confirmar tu reserva.

44. Beauty. si Maico sabay yakap sa akin mula sa likod.

45. Min erfaring har lært mig, at det er vigtigt at have en god arbejdsetik.

46. Eating a balanced diet can increase energy levels and improve mood.

47. Naging mayabong ang kaalaman ng tao dahil sa teknolohiya.

48. She reads books in her free time.

49. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

50. Spil kan have regler og begrænsninger for at beskytte spillerne og forhindre snyd.

Similar Words

styles

Recent Searches

pagkalitostylepahiramsilyaislandpersonsriskkalahatingmagpagupitgabi-gabiformatpag-aminmaipapamanatodonangjuliusgreaterpagtataposwashingtonfacilitatingsensibletshirtpaglalaitkalayuanvidenskabenpaangmasilipentertainmentartistmananahimetodiskwantmereumingitsigbayanabut-abotnagtagalililibrekumakalansingtelevisedpublicationnag-iyakanukol-kaywalngharpwesternipagtanggolkalaunanempresaspapanighomeskaymedidanasapakikipagbabagsumungawfe-facebookbook:itongflyvemaskinerestadosuponpalayoknakakaalamhiponhappenedtumababumaliklottomaramingmensahedesarrollardespuesgoalsummernatingalanagreplyincreasesagotinisa-isayanaltpantheonkaninokargaseryosongtaonisipinprimerosdatingmobilehampaslupamiyerkulesmadurasdraft:pinagsikapancharismatickaliwangdivisionvidtstraktnatingpuedekinagatmurangsipaelepantenakumbinsipromotingestablisimyentopamamagitannagisingdanmarkawitdiretsobalediktoryankastilangalapaaptonyosapagkatmataonoelsinonaisgroceryumuuwipagbebentatuginananaginipbowlrevolucionadoofferayoslangneverforeverpresyoinvitationpinagwikaanmbricosaudio-visuallytransportmidlertamadpagngitifull-timejuanapyschearbejdermagtigilsidoobstacleskinukuyombayaningpermitenlumakasmagbigaycrazypapasokenviarmaskibinabaandalahatinginiresetasentimosqualitytradesumingitgutomisladumarayonakipagbadmuntikanmagnifybihirasakupinnatulogproblemaayokosaangkaratulangnagkakatipun-tiponlibagblusashowshindeumaganagsunuranitsinyongsystems-diesel-runlupaintennaniwalabumaligtadhandaannagre-reviewtinikmancorners