Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "therefore"

1. He forgot his wallet at home and therefore couldn't buy lunch.

2. He was busy with work and therefore couldn't join us for dinner.

3. She had been studying hard and therefore received an A on her exam.

4. She loved to travel, and therefore spent most of her savings on trips.

5. She was feeling tired, and therefore decided to go to bed early.

6. The airport was busy, and therefore we had to arrive early to catch our flight.

7. The bridge was closed, and therefore we had to take a detour.

8. The car broke down, and therefore we had to call for roadside assistance.

9. The cat was sick, and therefore we had to take it to the vet.

10. The company had to cut costs, and therefore several employees were let go.

11. The event was sold out, and therefore we couldn't get tickets.

12. The meeting was cancelled, and therefore he had the afternoon off.

13. The movie was rated R, and therefore she wasn't allowed to watch it.

14. The phone rang late at night, and therefore she was hesitant to answer it.

15. The project was behind schedule, and therefore extra resources were allocated.

16. The restaurant didn't have any vegetarian options, and therefore we had to go somewhere else to eat.

17. The restaurant was full, and therefore we had to wait for a table.

18. The store was closed, and therefore we had to come back later.

19. The train was delayed, and therefore we had to wait on the platform.

20. The weather was bad, and therefore the game was cancelled.

21. Therefore, we should all steer clear of this bad habit of smoking cigarettes

Random Sentences

1. Hindi masikmura ni Lando ang ginawang kasamaan ng kanyang kaibigan.

2. Beber suficiente agua es esencial para una alimentación saludable.

3. Andyan kana naman.

4. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

5. He has been repairing the car for hours.

6. Nagpa-photocopy ng lumang diyaryo

7. Pwede ko ba makuha ang cellphone number mo?

8. Nagbalik siya sa batalan.

9. Limitations can be a result of fear or lack of confidence.

10. Ang mga nagtatagumpay sa negosyo ay madalas na itinuring bilang mga modelo ng tagumpay at inspirasyon para sa iba.

11. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

12. Hinugot niya ang kanyang bag sa ilalim ng mesa.

13. Bawal maglaro ng bola sa loob ng bahay dahil ito ay nakakasira ng gamit.

14. Nag-aaral si Maya sa Unibersidad ng Pilipinas.

15. Tinutulan ng komunidad ang anumang uri ng abuso laban sa mga kababaihan.

16. Magkano ito?

17. Elektronik kan være en kilde til underholdning og sjov.

18. Nilinis ng mga taga-Tungaw ang kanilang maruming ilog.

19. Merry Christmas po sa inyong lahat.

20. Hindi nawawala ang halaga ng panitikan sa pagpapalaganap ng kultura at kaalaman.

21. Good. Pahinga ka na. Dream of me. aniya.

22. Ang mga anak-pawis ay nangangailangan ng patas na pagkakataon upang magkamit ng tagumpay at umangat sa buhay.

23. Technology has also played a vital role in the field of education

24. Ano ang pinapanood mo sa telebisyon?

25. Sabi ko bumangon ka jan! Hoy!

26. Umiling lang siya tapos hinawakan yung kamay ko.

27. Lügen haben kurze Beine.

28.

29. Nagbabaga ang mga damdamin ng magkasintahan habang nag-aaway sila.

30. Nang umibig siya sa taga-lupang si Ramon, ang kanyang pagka-diwata'y tinalikdan niyang lubos upang mamuhay bilang ganap na tao.

31. Sa itaas ng burol, tanaw na tanaw ng lahat na nagdudumaling lumabas si Kablan sa tindahan.

32. Boboto ka ba sa darating na eleksyon?

33. Despite his success, Presley's personal life was plagued by controversy

34. Lazada's mobile app is popular among customers, with over 70 million downloads.

35. Umiiyak siyang gumuglong sa basa at madulas na semento.

36. Ano ang gustong palitan ng Monsignor?

37. Walang password ang wifi ng kapit-bahay.

38. Alay ko sa iyo ang bawat sandali ng buhay ko.

39. Hindi na niya narinig iyon.

40. Tweets are limited to 280 characters, promoting concise and direct communication.

41. "Kapag may tiyaga, may nilaga" ay isang bukambibig na nagpapahiwatig ng kahalagahan ng pasensya at pagsisikap upang makamit ang tagumpay.

42. Pumunta sila sa albularyo upang magpagamot ng kanyang pananakit ng likod.

43. Naglipana ang mga turista sa baybayin ngayong tag-init.

44. The Angkor Wat temple complex in Cambodia is a magnificent wonder of ancient Khmer architecture.

45. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

46. Ang taong lulong sa droga ay parang nasasakal na kaluluwa na patuloy na hinahanap ang paraan para lumaya.

47. Maganda ang pakiramdam kapag mayroon kang kaulayaw na makakasama sa buhay.

48. Biglaan akong natawa nang marinig ko ang kanyang joke.

49. Nasaan ba ang pangulo?

50. Malapit na matapos ang kanyang termino sa pagka senador.

Recent Searches

thereforecomeitimkumarimotcongratsabstaining1973pookdosemphasisdulatrueauthorpdatargetsulinganbulsasedentarytsebastaawitbehalfprogressrequirecomunicarseeffectsreallybetaonlynatingerannasundopatpattumabaconstitutionnaramdamanpumulotprincenasaktanmorningtumulongmakisigkindergarteninihandanewspaperswastolotpopulationibigaylosssharesusinteriorawayabimumuntingtaongpinagsulatklasengantibioticseconomyprovideatingbaleknowsbusilakelectoralpreviouslytinitindagodsandalingdustpanplanpag-aagwadornatatakotpag-irrigateincreasessamustevewalkie-talkiecoalduriannakatapatkansongfiverrmagta-trabahoreynamakasalanangngipingamerikabienbinilhantumangoeducationmaalikabokinatakesabadongkuwintasikinalulungkotnakiramaywatercnicohiyaisamatungkolbinigayginoongngumingisipublishedkartonghalikansabihingumibigmagpagupitpaglalabadapangkatthroatmaliittalamanuscriptpangilnilangkuwebasamang-paladreviewkaswapanganmaistorboalintuntuninplagasinalagaanpamangkinbinatilyongsinebinanggakerbsariliheartbreaktinanggapisinumpaiskodahanfigurespilalibromovingbilisautomaticfurmakahiramattractivenagsisigawmabiliskaloobangkinamumuhianinspirasyonginanginterestpagkakalutonakabulagtangpresidentialinteligentesagwadorpagsasalitanaglalakadnakikilalangnapakamisteryosonagniningningdilawnakaangatmarangalomfattendekalalaromag-inamaliksitagtuyotmag-aarallabing-siyambloggers,nagpalalimmabigyanaabotpublishing,itinatagmahuhulipinangalananmamahalinestasyonnangangakoprimerospaki-ulittinawagmangahasmakikitulogencuestaskinasisindakanpangangatawanleadersbulaklakaplicaciones