Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "therefore"

1. He forgot his wallet at home and therefore couldn't buy lunch.

2. He was busy with work and therefore couldn't join us for dinner.

3. She had been studying hard and therefore received an A on her exam.

4. She loved to travel, and therefore spent most of her savings on trips.

5. She was feeling tired, and therefore decided to go to bed early.

6. The airport was busy, and therefore we had to arrive early to catch our flight.

7. The bridge was closed, and therefore we had to take a detour.

8. The car broke down, and therefore we had to call for roadside assistance.

9. The cat was sick, and therefore we had to take it to the vet.

10. The company had to cut costs, and therefore several employees were let go.

11. The event was sold out, and therefore we couldn't get tickets.

12. The meeting was cancelled, and therefore he had the afternoon off.

13. The movie was rated R, and therefore she wasn't allowed to watch it.

14. The phone rang late at night, and therefore she was hesitant to answer it.

15. The project was behind schedule, and therefore extra resources were allocated.

16. The restaurant didn't have any vegetarian options, and therefore we had to go somewhere else to eat.

17. The restaurant was full, and therefore we had to wait for a table.

18. The store was closed, and therefore we had to come back later.

19. The train was delayed, and therefore we had to wait on the platform.

20. The weather was bad, and therefore the game was cancelled.

21. Therefore, we should all steer clear of this bad habit of smoking cigarettes

Random Sentences

1. Ada banyak kitab suci yang berisi doa-doa, seperti Al-Qur'an, Injil, dan Weda.

2. Paborito ko kasi ang mga iyon.

3. Kumain sa canteen ang mga estudyante.

4. Muling nabuo ang kanilang pamilya.

5. La visualisation et la réflexion sur ses réussites passées peuvent également aider à maintenir la motivation.

6. Si Jose Rizal ay napakatalino.

7. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

8. I'm going through a lot of stress at work, but I'm just trying to hang in there.

9. La creatividad se puede aplicar en cualquier campo de trabajo.

10. Narinig ko ang hinagpis ng mga magsasaka dahil sa mababang presyo ng kanilang ani.

11. Ang pagpapabaya sa mga ebidensya at katotohanan ay nagdudulot ng pagkaligaw sa landas ng katarungan.

12. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

13. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

14. Når man bliver kvinde, kan man opleve en række fysiske og følelsesmæssige forandringer.

15. Hindi kailanman matatawag na hampaslupa ang mga taong mahihirap ngunit nagta-trabaho ng marangal.

16. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

17. Kahit bata pa man.

18. Sino ang mga pumunta sa party mo?

19. A veces, la paciencia es la mejor respuesta ante una situación difícil.

20. Hay muchas hojas en el jardín después de la tormenta.

21. The Twitter Explore tab provides a curated feed of trending topics, moments, and recommended accounts.

22. I need to check my credit report to ensure there are no errors.

23. Hindi dapat natin ipagwalang-bahala ang mga babala at paalala ng mga eksperto, samakatuwid.

24. The United States also has a system of governors, who are elected to lead each individual state

25. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

26. Kagyat na bumaha ang nakaliliyong dilim sa kanyang utak.

27. El color y la textura son elementos fundamentales en la pintura.

28. Nagbuntong hininga sya, Akala ko naman.

29. Some people argue that it's better not to know about certain things, since ignorance is bliss.

30. El parto puede ser natural o por cesárea, dependiendo de las circunstancias y la salud de la madre y el bebé.

31. Marunong nang maglinis at magtago ang mga taong marurumi.

32. Ang ama, si Roque, ay mabait at mapagkalinga sa kanyang pamilya

33. Ano ba pinagsasabi mo! Baliw ka ba! Umalis ka nga!

34. Claro, haré todo lo posible por resolver el problema.

35. Bakit sumakit ang tiyan ni Tonyo?

36. Paano ka nakapasok sa bahay kagabi?

37. Tahimik na nanangis si Aling Rosa at laking pagsisisi dahil tumalab ang kanyang sinabi sa anak.

38. Wives can also play a significant role in raising children and managing household affairs.

39. Mommy. ani Maico habang humihingal pa.

40. Emphasis can help to ensure that a message is received and understood by the intended audience.

41. Ano namang inasikaso mo sa probinsya?

42. Tinanong niya ang mga kapitbahay kung nakita nila ang kanyang anak.

43. Mag asawa na kayo pero hindi mo pa nasasabing mahal mo siya?

44. Mababa ang kalidad ng produkto kaya hindi ito nagtagal sa merkado.

45. Dedication is what separates those who dream from those who turn their dreams into reality.

46. Yan ang totoo.

47. Dapat magkaroon ng sapat na proteksyon at benepisyo ang mga manggagawa at magsasaka bilang bahagi ng sektor ng anak-pawis.

48. Wala akong pakelam! Dapat sayo pinapalo!

49. Mi vecino tiene una labradora dorada que siempre corre a saludarme.

50. Kung kaagaw ko ang lahat, may pag-asa bang makilala ka?

Recent Searches

connectionmind:thereforecharitablecomputerinitefficienterrors,programmingmagpalagoagaw-buhaysultanlegendsmakinigmagulangpatiderkailanganislakaugnayanasawapinangyarihanpaghangadogmahuhulidulimapilitangnyannatanongpansitnagagamitanimsigesamakatwiddisyemprepamamagakakayurinpanatilihinmaligobundokmagingiyodumikitnaunagurorespektivetalagaitsbiocombustibleskaninangwalaumuwingnagpanggapkumembut-kembothumpaypadabogtsetuhodfieldpilipinomatsingkumakapitbigyaninakyatempresaspagguhitkatiepamamagitanpigingtumakasinabotmabatongpabalikvarietymelissanagsiklabpanalangindelestyresarilingknowbaku-bakongsponsorships,pagsasalitanangagsipagkantahanmagbagong-anyocultivanagpepekenawalangsasagutinpaghihingalonanghahapdisasayawinnalalabimungkahinaibibigaypinag-aaralankomedordyipnimahuhusaypinagbigyannatabunanmagsungitlumibotbwahahahahahatennismagagamitgumuglongkagubatanpaninigaspasaheroharapanpalamutimabangostayandrewkumanannumerososkakaibanglumulusobbahagyangissuespagiisipescuelasumulantinikmanhalinglingminahanpresencebaguioisipanenglandnapilitangdiapernasuklamgigisingenergyelenagrowthsuwaillazadakuwebaexpertisemaasimyunumalisabanganlandenagpuntapalagisawamapaibabawblazingvehiclesmassesboracaynuonfraasinpaysumugodsusunduindeathsantosgodaudio-visuallyconventionalwalletangdinluisactingballoffersurgeryellenhardsumapitnatinagwealthbendingginhimactiondigitaldraft:siranasunogbansangindustriyacontinuedbatayfinishedbackpackmatchinglungkotmapagkatiwalaandiyosangduguanpagpalit