Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "fury"

1. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

Random Sentences

1. Wer im Glashaus sitzt, sollte nicht mit Steinen werfen.

2. Nagsayaw sa entablado ang mga mag-aaral nang limahan.

3. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

4. Sa tabing-dagat, natatanaw ko ang mga isda na lumilutang sa malinaw na tubig.

5. Kasalukuyan siyang nagtitiis sa init nang may maulinigan siyang siga mula sa tindahan.

6. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

7. Gawan ninyo ng paraang makalabas po sana ako sa pagkakakulong ko sa loob ng prutas na ito.

8. Nasawi ang drayber ng isang kotse.

9. Weddings are typically celebrated with family and friends.

10. AI algorithms can be used in a wide range of applications, from self-driving cars to virtual assistants.

11. Pahiram ng iyong payong, mukhang uulan na mamaya.

12. Oh gosh. Inintay pa sya ng prince, what does it mean?

13. Akin na kamay mo.

14. Ang palay ay hindi bumubukadkad kung walang alon.

15. The TikTok algorithm uses artificial intelligence to suggest videos to users based on their interests and behavior.

16. Hindi ho ba madilim sa kalye sa gabi?

17. Bilang paglilinaw, ang sinabi kong oras ng meeting ay alas-dos ng hapon, hindi alas-tres.

18. Ayaw sumindi ng ilaw. Pundido na yata.

19. Les personnes âgées peuvent souffrir de diverses maladies liées à l'âge, telles que l'arthrite, la démence, le diabète, etc.

20. Paki-charge sa credit card ko.

21. Itinaob niya ang kaunting nasahod na balde at ang tubig ay gumapang sa semento at umabog sa kanilang mga paa ni Ogor.

22. Payapang magpapaikot at iikot.

23. The objective of hockey is to score goals by shooting the puck into the opposing team's net.

24. El maíz es propenso a ataques de plagas como la oruga y la langosta del maíz

25. In recent years, television technology has continued to evolve and improve

26. Sambil menyelam minum air.

27. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

28. El conflicto entre los dos países produjo tensiones en toda la región.

29. Marami ang nahuhumaling sa larong mobile legends.

30. Kanina pa kami nagsisihan dito.

31. Nangagsipagkantahan kami sa karaoke bar.

32. Ang sugal ay maaaring magdulot ng pagsisira sa relasyon at pamilyang pinansyal.

33. La película que produjo el estudio fue un gran éxito internacional.

34. Me siento cansado/a. (I feel tired.)

35. Platforms like Zoom and Skype make it easy to connect with students or clients and provide your services

36. Puwede bang makausap si Maria?

37. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

38. Ngumiti lang sya, I know everything, Reah Rodriguez.

39. Elektronik kan hjælpe med at forbedre sikkerhed og beskyttelse af data.

40. Kami kaya ni Maico aabot sa ganyan?

41. Gusto ko na magpagupit ng buhok.

42. Las hierbas deshidratadas se pueden almacenar por más tiempo sin perder su sabor.

43. El nacimiento es un evento muy emocionante y significativo en la vida de una familia.

44. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

45. Twinkle, twinkle, little star.

46. They are not running a marathon this month.

47. Viruses can have a significant impact on global economies and healthcare systems, as seen with the COVID-19 pandemic.

48. The king's coronation is a ceremonial event that officially marks his ascension to the throne.

49. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

50. Sa bawat salita ng kundiman, nararamdaman ang pait ng paghihintay at pangungulila.

Recent Searches

bernardotelangtryghedfurysumamasolidifybathalahapasinpilingclassesprogramsbabebehinduseewanpondonabigkaspropesorespecializadasumanonariningbabamarahansukatinkinakaligligganapulongculpritsurroundingspersonideyasagotmagbasaninumanipantalophomealwayshistorygumisingnabitawanmisadingdingtrentaeditorminahanimaginationkasidinshiftvivatopicpabulongmartapagkakapagsalitapagkakataonbilihinkapatawaranbosestongkumukuha1940pagkaawapagkakayakaprenombreposporogayundinnapakahangamaarawmaawaganitoginaganapnakangisiisulatdekorasyonbuung-buonagtataasnakadapapagsalakayvirksomhedermagpagupittinakasanmaisusuotnagwagihandaanlumuwasmasaksihannakaraangandahannagmadalingfestivalesitinuturokaninokanluranpanindamusicalessenadormadungisnapasubsobmaintindihanyumaomakabawilabinsiyamtherapykesobinuksanmagkabilanginlovenanangismabagaltutusinmakaiponharapanmangyarileegrightspunonaabutanniyanpartsnabiglafavoreconomicbutterflyctricasgirayhabitsbusiness:nawalabefolkningenhinatidbanlagnagdaoscampaignskakayanangkakayananmagsimulaturonasawaalagatanawbihasalubosbalingannasasmilelazadaforståfederalmaatimsadyangaregladobutasnewspapersrevolutionizedsumigawkananvetoconsumepatayshinesmayamangdefinitivokriskalipadquezonsuccessjoevalleylotpanotapehitikwalongtarcilapriestflavioconsistminutobuwanmaluwanginantokmakisigdeteriorateeuphoricdreamfar-reachingorderinbarohumanowowsorematchingbasahanvampirespostcardsaanbataysukatcollectionsdalaw