Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "natutulog"

1. Ang kulambo at unan ay karaniwang ginagamit upang mapanatili ang kaginhawaan habang natutulog.

2. Ang mga sanggol at bata ay madalas na natutulog ng mahabang oras sa isang araw.

3. Anong oras natutulog si Katie?

4. Hmmm natutulog yung tao eh. Wag ka ngang sumigaw.

5. May mga taong nagkakaroon ng mga panaginip tuwing natutulog sila.

6. Nung nagplay na, una kong nakita yung sarili ko. Natutulog.

7. Pinagmasdan ko sya habang natutulog, mukha syang anghel...

8. Sa pagbabasa ng magandang libro, napapasaya at natutulog ako nang matiwasay sa gabi.

9. Tuwing gabi, ang mga tao ay nagpapahinga at natutulog upang mag-refresh ang kanilang katawan at isip.

Random Sentences

1. I prefer to arrive early to job interviews because the early bird gets the worm.

2. Ang mga indibidwal na may marahas na asal ay maaaring humantong sa pagkakasangkot sa legal na problema.

3. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

4. Bilang paglilinaw, ang ating proyekto ay hindi pa tapos kaya hindi pa ito maaaring ipasa.

5. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

6. The dedication of mentors and role models can positively influence and shape the lives of others.

7. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

8. Es importante ser honestos con nosotros mismos para tener una buena conciencia.

9. Binantaan ng mga sibilyan ang magnanakaw bago ito tumakas.

10. Christmas is a time of joy and festivity, with decorations, lights, and music creating a festive atmosphere.

11. All these years, I have been cherishing the relationships and connections that matter most to me.

12. It’s risky to eat raw seafood if it’s not prepared properly.

13. Nous avons eu une danse de mariage mémorable.

14. Les hôpitaux peuvent être des environnements stériles pour prévenir la propagation des infections.

15. The baby is sleeping in the crib.

16. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

17. Give someone the benefit of the doubt

18. Masakit ang ulo ng pasyente.

19. The dog barks at strangers.

20. Beyoncé is a highly acclaimed singer, songwriter, and actress known for her powerful performances and chart-topping hits.

21. Disse inkluderer terapi, rådgivning og støttegrupper.

22. Binigyang diin niya ang pagpapasakit ng Anak ng Diyos.

23. Bwisit ka sa buhay ko.

24. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

25. Ang saranggola ay simbolo ng kasiyahan noong kabataan.

26. Binigyan niya ako ng aklat tungkol sa kasaysayan ng panitikan ng Asya.

27. Sumagot agad si Kuya isang ring pa lang.

28. Les patients peuvent être transférés dans des unités de soins spécialisées en fonction de leur état de santé.

29. Sa araw ng pamamamanhikan, dala-dala ng pamilya ng lalaki ang mga handog para sa pamilya ng babae.

30. The patient's family history of high blood pressure increased his risk of developing the condition.

31. Hindi dapat mawala ang kalayaan sa pagpili ng ating sariling relihiyon at pananampalataya.

32. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

33. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

34. Napakagaling nyang mag drawing.

35. Si Maria ay na-suway sa utos ng guro na tapusin ang kanyang takdang gawain.

36. Si mommy ay matapang.

37. Kucing juga dikenal sebagai pembasmi tikus dan serangga di rumah atau tempat tinggal.

38. We finished the project on time by cutting corners, but it wasn't our best work.

39. Guten Tag! - Good day!

40. Sa bawat Chinese New Year, ang mga tao ay nagbibigay ng mga bagong larawan at dekorasyon upang ipagdiwang ang bagong panimula.

41. Hinde naman ako galit eh.

42. Les personnes qui ont une passion pour ce qu'elles font sont souvent plus motivées à y consacrer leur temps et leur énergie.

43. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

44. Limitations can be a source of motivation to push oneself to achieve more.

45. Some sweet foods have cultural and religious significance, such as honey in Jewish traditions and dates in Muslim traditions.

46. Maraming bansa ang nagkakaisa upang magbigay ng tulong sa mga bansang naapektuhan ng digmaan.

47. At være transkønnet kan være en udfordrende, men også en berigende oplevelse, da det kan hjælpe en person med at forstå sig selv og verden på en dybere måde.

48. Mayroon akong mga alinlangan sa kanilang plano kaya ako ay tumututol dito.

49. I have never been to Asia.

50. Scissors can have straight blades or curved blades, depending on the intended use.

Recent Searches

barrerasdireksyonlikodtalinonatutulogmatagumpaynaguusapmatangumpaydisciplinrecibirperseverance,naglipananangingilidlilipadlilikohunimagtanimniyanmakausapsakithihiganatagalannagisingnakinigalasnovembero-orderbiyaspokerkinamataaascashhinintaymabigyanwingbilihinaircontogetherpogibumotowaterlinawhumbleorderinproudmatabangcompositoresbulaknoonmadadaladalanghitabilaotrentiniounitedaabothugismapahamakmanuksomansanasiconicadoptedenforcingdumipagkuwanschedulehojaskantosantosaidsnobtransmitssumayatapatvalleyisinalangletterrabbaitinalagangritopocajerrytomaradverselypinalutotodogisingatinpingganbrindartuwanglalonglangstrengthpublishingcoinbaseexpertbigmapaikotsamuoncecompartennamingdecisionspagkapasanpamilyanglumusobprobinsiyatiyadivideshitiklimitipapahingadollarspeechschooloverviewfascinatingchefgamitstudentsextremistnagbakasyonkapilingputingexamplesenadordecreaserefhawakbetweenipinalitulingryanstyrernapakagandangnangyayariusakatandaanmahalaganagbibiropisarasabongmatayogkisapmatagustomakatulogkalikasantakekatulongpulgadanamumuoganangfeelpagtungotuvomakikiraanvelfungerendespeechesarbejdsstyrkemorenalenguajebulakalakumuuwipupuntautilizarmagitanongtodaydaigdigpormag-ibadagahinamonalokaraw-arawcharismatickwartoasukalkauntidikyamprincipalesboxbarmatalikeskuwelanapatingindaratingamazonpusanatutoktinungoeuphoricjaysoninintaypanalabisnanunuksokonsultasyonmakukulay