Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "larry"

1. Larry Bird was a versatile forward and one of the best shooters in NBA history.

2. Saan pupunta si Larry sa Linggo?

Random Sentences

1. Hindi ko sinasang-ayunan ang kanilang ideya kaya ako ay tumututol.

2. Børn bør lære om bæredygtighed og miljøbeskyttelse for at bevare vores planet.

3. Namamangha at nananaghili sa ganda ng magkakapatid ang mga dalaga sa kanilang nayon.

4. Ang mailap na mga bagay ay kailangan paglaanan ng oras at pagsisikap upang makamit.

5. Ang pangalan niya ay Ipong.

6. Nakalimutan ko na biglaang may appointment ako kanina kaya hindi ako nakapunta.

7. Maaliwalas ang simoy ng hangin sa probinsya.

8. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

9. Nag-alok ng tulong ang guro sa amin upang matugunan ang mga hamon ng bagong kurikulum.

10. The charity organized a series of fundraising events, raising money for a good cause.

11. Siya ang pangunahing lider ng Katipunan sa Cavite.

12. Limitations can be self-imposed or imposed by others.

13. Ang mga sanggol at bata ay madalas na natutulog ng mahabang oras sa isang araw.

14. Ang kanyang galit ay parang nagbabaga, handang sumiklab anumang oras.

15. Waring may nais siyang sabihin, ngunit pinili niyang manahimik.

16. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

17. Kung may tiyaga, may nilaga.

18. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

19. El nacimiento de un hijo cambia la dinámica familiar y crea un lazo fuerte entre los miembros.

20. Hindi siya maramot sa pagbibigay ng kanyang mga lumang damit sa mga nangangailangan.

21. A lot of traffic on the highway delayed our trip.

22. La creatividad nos permite expresarnos de manera única y personal.

23. May gusto lang akong malaman.. I have to ask him.

24. He set up a charitable trust to support young entrepreneurs.

25. Pumunta sila dito noong bakasyon.

26. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

27. Umuuwi siya sa probinsiya linggo-linggo.

28. La prévention est une approche importante pour maintenir une bonne santé et éviter les maladies.

29. Si Hidilyn Diaz ay tinawag na “Pambansang Bayani” sa larangan ng palakasan.

30. Sa mga kasal, kadalasan ay mayroong pagbibigay ng regalo sa mga panauhin bilang pasasalamat sa pagdalo.

31. Il existe un certain nombre d'organisations et de programmes qui offrent de l'aide aux personnes luttant contre la dépendance au jeu.

32. Sa bawat pagkakataon, dapat nating ipaglaban at ipagtagumpay ang ating kalayaan.

33. Tengo que tener paciencia para lograr mi objetivo.

34. Hindi ko kaya itago ang aking damdamin, kaya sana pwede ba kita ligawan?

35. Danske virksomheder, der eksporterer varer til USA, har en betydelig indvirkning på den amerikanske økonomi.

36. I saw a pretty lady at the restaurant last night, but I was too shy to talk to her.

37. Like a diamond in the sky.

38. Les jeux peuvent avoir des règles et des limitations pour protéger les joueurs et prévenir la fraude.

39. Ang pagpapakilala ng bagong lugar o setting ang nagbigay ng bagong perspektibo sa kuwento sa kabanata.

40. Sa harap ng tore, natatanaw ko ang ganda ng arkitektura at kahalagahan ng kasaysayan.

41. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

42. Ang mga mag-aaral ay nag-aapuhap ng karagdagang oras para mag-ensayo para sa kanilang mga pagsusulit.

43. Tumagal ng ilang araw bago mawala ang pamamaga ng kanyang paa.

44. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

45. Oh masaya kana sa nangyari?

46. Umihip ang malamig na hangin, waring may paparating na masamang balita.

47. The new factory was built with the acquired assets.

48. Women make up roughly half of the world's population.

49. L'enseignement est un métier noble qui consiste à transmettre des connaissances aux élèves.

50. Dette skyldes, at den offentlige regulering sikrer, at der er en vis grad af social retfærdighed i økonomien, mens den frie markedsøkonomi sikrer, at der er incitamenter til at skabe vækst og innovation

Recent Searches

larryitinuturingpeterbabaeplatformschadlongchambersheipollutionimpacthusograceworrysangkalanprogramming,visualmulingstructurepilingactivityenvironmentmalakingstreamingpointmesaregularmentecomofamilynagpagawamakalaglag-pantysiyudadkapalorganizematigashunyovehiclespagkakapagsalitapssspatutunguhanpakipuntahanflaviopagkabuhaynagawangpagkatakotsalbahenghukayhinahanapmahinahongpopularizesumabogpookmoodspillpagkalitounahumiwalaypreviouslyadvancedeveryeditorsaritagagawinmagbabagsiknagmamadaliramdamkinauupuantakesattentionbotonoongsameiwinasiwascomputerpag-irrigateformsknowledgeintelligenceeffectpagpilipupuntahansasamahandahan-dahanpamilihandahondreamshumahangoskindergartensunpalagingpamamasyalpagbabantanatinagaksidentebasketbollalimbalitacapacidadisipanautomationtableiyomalihiscondosoccerchessfianotebooktriplcdkelanusoinfusionestog,biologipalancaspeechnagdaosdeterminasyondiversidaduniversitiestonyestámagtigilkulturnuevoscareerpataykinganghelaabotvalleytumatawagknownengkantadangpumapaligidmadalasthesededicationnakatirangmerchandisetumatakbobighanipagputinalugmoksportskapangyarihannagdadasalmagnakawmakilalamagbibigayskypenagluto00amnaghuhumindigkonsyertodaratingadvancesinterestsnagaganappinagwagihangislatalagapadabogresortcoatnecesarioappmakikitulogmahirapmagdoorbelloktubrepootcaraballoperokatutubogayunmanbaokumarimotpesosgarbansosumiwasnagsasagotayawentreempresasmangahaspag-uwileveragedevelopitukodpagsuboklumilingongawainggubatgitanasbumangonsumingiteditsoftware