Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "responsible"

1. Congress, is responsible for making laws

2. Football referees are responsible for enforcing the rules of the game and ensuring player safety.

3. Foreclosed properties may have back taxes or other outstanding debts, which the buyer may be responsible for paying.

4. Hockey referees are responsible for enforcing the rules of the game and ensuring player safety.

5. Hospitalization can be expensive, and patients may be responsible for paying for medical bills and other associated costs.

6. Supreme Court, is responsible for interpreting laws

7. The authorities were determined to find the culprit responsible for the environmental damage.

8. The culprit responsible for the car accident was found to be driving under the influence.

9. The executive branch, represented by the President of the United States, is responsible for enforcing laws

Random Sentences

1. Ang pag-ulan ay nagpawi ng init at tuyot sa lupa.

2. He could not see which way to go

3. Ilang tao ang pumunta sa libing?

4. Nagdulot umano ng matinding trapiko ang biglaang pagkasira ng tulay.

5. She's trying to consolidate her credit card debt into a single loan with lower interest rates.

6. Kucing di Indonesia juga sering dibawa ke salon kucing untuk melakukan perawatan bulu dan kesehatan mereka.

7. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

8. Einstein was born in Ulm, Germany in 1879 and later emigrated to the United States during World War II.

9. Kapag ang tao ay may tiyaga, kahit maliit na bagay ay may tagumpay.

10. No puedo cambiar el pasado, solo puedo aceptarlo con "que sera, sera."

11. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

12. Pumapasok siya sa unibersidad araw-araw.

13. Sa mga bundok, ang mga mountaineer ay nagtatanim ng puno upang mabawasan ang pagkaagnas ng lupa.

14. Trump's handling of the COVID-19 pandemic drew both praise and criticism, with policies like Operation Warp Speed aiming to accelerate vaccine development.

15. Noong unang panahon may nakatirang mag-ina sa isang malayong pook.

16. Puwede ba akong sumakay ng dyipni?

17. May nagpapaypay May kumakain ng halu-halo.

18. Humingi siya ng makakain.

19. Nilinis namin ang bahay kahapon.

20. Ang tubig-ulan ay nagbibigay ng kahalagahan sa mga pangangailangan ng mga tao, tulad ng pag-inom at pangangailangan sa pagsasaka.

21. Kape ang iniinom ni Armael sa umaga.

22. The cake you made was absolutely delicious.

23. Huh? Paanong it's complicated?

24. Kasalukuyan siyang nagtitiis sa init nang may maulinigan siyang siga mula sa tindahan.

25. Matuto kang magtipid.

26. Oh gosh. Inintay pa sya ng prince, what does it mean?

27. Mahalaga ang listahan para sa mga malilimutin tulad ni Lita.

28. Hinintay lamang niya ang aking pagdating.

29. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

30. Lumitaw ang bungang-araw niya sa likod at leeg.

31. Malakas ang narinig niyang tawanan.

32. Mathematical concepts, such as fractions and decimals, are used in daily life, such as cooking and shopping.

33. Huwag magpabaya sa pag-save at pag-invest ng pera para sa kinabukasan.

34. Sa dakong huli ko lang narealize na mali ang ginawa ko.

35. Ang paglilinis at pag-aayos ng bahay ay isa sa mga tradisyonal na gawain tuwing Chinese New Year.

36. Foreclosed properties may be sold through real estate agents or brokers, who can help buyers navigate the purchase process.

37. Bakit? Dahil ba mahahawa ako sa sakit mo? concern ba sya?

38. Patients may be hospitalized for a variety of reasons, including surgery, illness, injury, or chronic conditions.

39. Nasaan si Trina sa Disyembre?

40. May isang umaga na tayo'y magsasama.

41. Samahan mo ako sa mall for 3hrs!

42. The scientific method involves forming hypotheses and testing them through experiments.

43. Masyadong mahal ang pagkain sa hotel.

44. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

45. Sa loob ng paaralan, ang ingay ng mga mag-aaral ay binulabog ang kasiyahan ng mga guro.

46. Les écoles offrent des bourses pour aider les étudiants à payer leurs frais de scolarité.

47. Tahimik ang buong baryo sa takipsilim.

48. Kakutis ni Kano ang iba pa niyang kapatid.

49. You reap what you sow.

50. Ang pagbisita sa mga magagandang tanawin o pook turistiko ay isang nakagagamot na paraan upang mabawasan ang stress.

Recent Searches

ngunitipinagraberesponsibletumikimnagdudumalingactivityconsiderfacultyspreadthoughtsmereprovidedmaestromininimizeloansleftipinanganakhappenedgusting-gustoeksport,armedwhateverpinabulaanpamumunodarkbakeledresourcesnatingnagngangalangbabanagkasunogarbularyokinumutanwriteyeahpublishedpaulit-ulitkamandaggawinsinisiraalambalotthereforetwinklemagasawangnalalabifauxlargermakaratingmandirigmangkamalayandiseasenatitirangmasungitsquatterpotentialbathalaboxhimigkinakitaanpinagkaloobanpagluluksanakikini-kinitanamumukod-tangibaku-bakongsponsorships,vehiclesblazingitinagoapoypogitikettwo-partyairconstrugglednogensindelipadtalentiyonpanindangsikopublicationalasmaidpatunayannagmungkahitinulak-tulakeskuwelahanmakapangyarihanmakikitagobernadorpinagtagponakapamintanakakuwentuhanmagkahawakgeologi,nagkitavirksomheder,nakapagngangalitsumisiliplayaworganizesalatinmanilabiyasnaalisracialfe-facebookomfattendepalapagkakayanangendvidereemocionalsakaymagtanimsementojolibeepinisilbarcelonamarsoofficefeelknow-howdisappointjackzotrasgabebotespeecheshearsaannamtonpakainipanlinistapossufferpartyclassesexamplekapilingprogramaprogramsstringgitanaspatrickulingdifferentconstitutionrecentcontrolledstyrerdraft,effectsheftyfallwhichpamilyangnamumulotnapapasayamahawaannagnakawmatalinopinabayaannasasakupanpalabuy-laboykarununganmaglalaronakalilipaspamanhikannakatirangnanahimiknananaginippakanta-kantangnapapalibutanmahinoghandaannakakamitnangangalitnaapektuhanforskel,mawawalamagpalagopagkatakotsasamahanpalaisipandadalawintreatsnagawangnakatalungkona-suwaykahaponmahiwagangpumapaligidmang-aawitpaki-translatereserbasyonkasaganaan