Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "responsible"

1. Congress, is responsible for making laws

2. Football referees are responsible for enforcing the rules of the game and ensuring player safety.

3. Foreclosed properties may have back taxes or other outstanding debts, which the buyer may be responsible for paying.

4. Hockey referees are responsible for enforcing the rules of the game and ensuring player safety.

5. Hospitalization can be expensive, and patients may be responsible for paying for medical bills and other associated costs.

6. Supreme Court, is responsible for interpreting laws

7. The authorities were determined to find the culprit responsible for the environmental damage.

8. The culprit responsible for the car accident was found to be driving under the influence.

9. The executive branch, represented by the President of the United States, is responsible for enforcing laws

Random Sentences

1. Tumingin siya saken at sa malungkot na mukah ay umiling.

2. Sa paligid ng balde, nakikia niya ang kanyang anino.

3. La película que vimos anoche fue una obra sublime del cine de autor.

4. I learned early on that there's no such thing as a free lunch - everything comes with a cost.

5. "A dog is the only thing on earth that loves you more than he loves himself."

6. Sa loob ng simbahan, natatanaw ko ang magandang retablo at mga banal na imahe.

7. Ang malalakas na tama ng kidlat ay binulabog ang langit at nagdulot ng takot sa mga tao.

8.

9. Napakagandang dalaga, wika niya sa sarili at tuloy-tuloy na nilapitan niya ito.

10. Vivir con una conciencia limpia nos permite dormir mejor por la noche.

11. Walang sinasabi ang mga ito, ngunit sa mga mata, sa galaw ng mga labi nababasa nya ang isinisigaw ng mga paslit.

12. Ang guro ko sa Panitikan ay nagturo sa amin ng mga panitikan mula sa iba't ibang panahon.

13. Alas-tres kinse na po ng hapon.

14. Bago siya ipinatay, si Rizal ay isang aktibistang politikal na lumaban sa korupsiyon at pang-aabuso ng mga Espanyol sa Pilipinas.

15. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

16. Aling hiwa ng baboy ang gusto mo?

17. Tinangka umano ng pulis na kausapin ang mga nagpoprotesta bago sila buwagin.

18. I like how the website has a blog section where users can read about various topics.

19. They were originally established in 1947 as the Minneapolis Lakers before relocating to Los Angeles in 1960.

20. Sino ang kasama ng ate mong naglakad kahapon?

21. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

22. Sang-ayon ako na kailangan nating magkaroon ng sapat na pondo para sa pagpapaunlad ng ating mga komunidad.

23. Namnamin mo ang halik ng malamig na hangin sa umaga.

24. Limitations can be a source of motivation to push oneself to achieve more.

25. Kebahagiaan sering kali tercipta melalui perspektif positif, menghargai hal-hal sederhana, dan menikmati proses hidup.

26. Nakatingala siya kay Ogor, mahigpit na kinukuyom ang mga palad.

27. Paglingon ko, nakita kong papalapit sakin si Lory.

28. Sa kaibuturan ng kanyang damdamin, mahal niya ang kanyang mga kaibigan.

29. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

30. I love you so much.

31. Sa tuwing naaalala ko ang mga masasakit na pangyayari, hindi ko mapigilang maglabas ng malalim na himutok.

32. The team’s momentum shifted after a key player scored a goal.

33. Bilang paglilinaw, ang pagsasanay ay para sa lahat ng empleyado, hindi lang sa bagong hire.

34. Fødslen kan være en tid med stor stress og angst, især hvis der er komplikationer.

35. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

36. Me da miedo pensar en lo desconocido, pero al final, "que sera, sera."

37. Musk has expressed interest in developing a brain-machine interface to help treat neurological conditions.

38. Bakit ba gusto mo akong maging bestfriend?!

39. Nasa Ilocos si Tess sa Disyembre.

40. Tumututol ako sa kanilang plano dahil alam kong may mas magandang paraan para matupad ang layunin nito.

41. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

42. Inalis ko yung pagkakayakap niya sa akin. At umupo sa sofa.

43. La menta es una hierba refrescante que se utiliza en bebidas y postres.

44. Mathematics is a language used to describe and solve complex problems.

45. Ang tarangkahan ay gawa sa matibay na kahoy at bakal.

46. Dogs can provide a sense of security and protection to their owners.

47. Oy saan ka pupunta?! sigaw nya.

48. Las plantas acuáticas, como los nenúfares, se desarrollan y viven en el agua.

49. Walang anak sina Mang Kandoy kaya't ganoon na lamang ang dasal nila sa Panginoon upang mabigyan sila ng anak.

50. Napatingin ako sa may likod ko.

Recent Searches

santosresponsiblebesespakakatandaanlistahantripdakilangcitizencompaniesroughvaliosakamalayanconectanpunongkahoyilawnagsasabingbalahibobugtongtinitirhaninangatfilmkinikitasparerepresentedmaaksidenteisulatnagisingflaviomabaitokaykinakailanganenfermedadeskumananemocionantebirdsdeliciosahanapinadangeksempelsimplengasomapuputimagpapagupitnagbakasyoniilanwastedulotnangingilidblusangsagaptaosnaglutomaliwanagkumbentotypeslumamangcorrectingbestidanatapakangabingdadalobulatebatibiglaankoryentemanatilisenadorpitakanakalagaykinainterior1980resultbyggetofrecenliablesaferlackchaduntimelytahimikmaninirahankubotermmagselostumatawadinalispronounpinigilandekorasyoncnicoartistatenidobiologitherapyipinauutangheykaratulangsweetmeriendadogstelanginvesting:palancamasyadongnagkasakitpinakidaladinadaananipinalitilihimhoneymoonmahinangdurimahabolnapadaannaglabakasipedematangkadginagabi-gabikalakiuusapandilawnakagawianpinangalanangmayamanburmamataaasmatalimpresyobwahahahahahatrainstinulak-tulaknaantigmagturodaigdigramdamnoonmonumentohastahimigmagsalitabrideneaagilacommunicationsnakakasamasabonglaterturnpagkakapagsalitatatagalnagpapaigibmasaganangbayadpaldamakasalanangwealthmulifurthersiyudadbabarabegroceryrestawanmanonoodmagigitingmakaratingwindowseniorlarrygrabedoktorsinakopnananaginippagdiriwangfrescosearchmanuscriptaddlapitanjeromemakakabaliklumilipadformsmagkanotechnologicalsampungpeteradditionallynababalotsharingsagotmalapadmaligayamagpagupitbisitafonosomelette