Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "responsible"

1. Congress, is responsible for making laws

2. Football referees are responsible for enforcing the rules of the game and ensuring player safety.

3. Foreclosed properties may have back taxes or other outstanding debts, which the buyer may be responsible for paying.

4. Hockey referees are responsible for enforcing the rules of the game and ensuring player safety.

5. Hospitalization can be expensive, and patients may be responsible for paying for medical bills and other associated costs.

6. Supreme Court, is responsible for interpreting laws

7. The authorities were determined to find the culprit responsible for the environmental damage.

8. The culprit responsible for the car accident was found to be driving under the influence.

9. The executive branch, represented by the President of the United States, is responsible for enforcing laws

Random Sentences

1. Today is my birthday!

2. Gawa/Yari ang Tshirt sa Tsina.

3. Nagbabakasyon ako tuwing Abril.

4. It's nothing. And you are? baling niya saken.

5. El atardecer en el mar es un momento sublime que muchos aprecian.

6. It's frustrating when people beat around the bush because it wastes time and creates confusion.

7. Ang kanyang presensya sa aming pagtitipon ay lubos naming ikinagagalak.

8. Cigarettes made of tobacco rolled in tissue paper helped spread a very harmful habit among the so-called advanced countries of the West

9. Congress, is responsible for making laws

10. Omelettes are a popular choice for those following a low-carb or high-protein diet.

11. Madalas siyang sumusulat kapag nag-iisa.

12. Allen Iverson was a dynamic and fearless point guard who had a significant impact on the game.

13. Ibinigay ko ang aking tulong sa mga naghihirap upang masiguro ang kanilang kaligtasan.

14. Humayo ka at hanapin mo ang dalagang sinasabi ko para mabalik ang dati mong anyo, ang utos ng engkantadang babae.

15. La película produjo una gran taquilla gracias a su reparto estelar.

16. My boyfriend took me out to dinner for my birthday.

17. Nakita niyo po ba ang pangyayari?

18. Les universités offrent des programmes d'études en ligne pour les étudiants à distance.

19. Scissors can have straight blades or curved blades, depending on the intended use.

20. Les personnes âgées peuvent avoir des difficultés à se déplacer ou à effectuer des tâches quotidiennes.

21. Hindi ko maintindihan kung bakit kailangan ko pang magtiis sa ganitong sitwasyon.

22. Terima kasih banyak! - Thank you very much!

23. Scientific analysis has revealed that some species are at risk of extinction due to human activity.

24. Le travail est une partie importante de la vie adulte.

25. Tinatawag niya ang anak ngunit walang sumasagot.

26. Ang mga eksperto sa kalusugan ay nagbahagi ng kanilang mga mungkahi upang mapabuti ang mga programa sa pangangalaga sa kalusugan.

27. The event was sold out, and therefore we couldn't get tickets.

28. Paano mo nalaman? tanong ko sa kanya.

29. The love that a mother has for her child is immeasurable.

30. Ngunit sa lahat, siya ang may pinakalutang na kagandahan.

31. Ang monumento ni Mabini ay matatagpuan sa may lalawigan ng Batangas.

32. Ariana Grande is also an advocate for mental health awareness, openly discussing her experiences with anxiety and PTSD.

33. Tinawag nilang ranay ang insekto na katagalan ay naging anay.

34. Kung ako si Maico? Malamang magwawala ako. aniya.

35. Hinde mo pa nga pinapatapos yung sasabihin ko eh.

36. If you did not twinkle so.

37. Si Hidilyn Diaz ay isang inspirasyon para sa maraming Pilipino, lalo na sa mga kabataan.

38. Malungkot ang lahat ng tao rito.

39. The United States is a leader in technology and innovation, with Silicon Valley being a hub for tech companies.

40. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

41. Ang bayanihan ay isang tradisyonal na gawain kung saan ang mga taga-komunidad ay nagtutulungan para sa isang layunin.

42. Magic Johnson was a skilled playmaker and led the Los Angeles Lakers to multiple championships.

43. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

44. Hindi dapat supilin ng mga magulang ang mga pangarap ng kanilang mga anak.

45. Bilang paglilinaw, hindi ako nagbigay ng pahintulot sa pagbabago ng plano.

46. Det giver os mulighed for at udføre mange forskellige opgaver, fra simpel redigering af tekst til avancerede beregninger og simuleringer

47. En helt kan være enhver, der har en positiv indflydelse på andre mennesker.

48. El cuaderno de Leonardo da Vinci contiene muchos dibujos y anotaciones sobre sus inventos.

49. Advances in medicine have also had a significant impact on society

50. Tu peux me passer le sel, s'il te plaît?

Recent Searches

wealthdecisionssedentaryresponsibleginisingumiinitdelebilerniyomediumcertainbakeumilinginterviewingstopdedicationlibrorelievedawitimportantenilaawardmawalaibinentahouseatingcanadaika-50speechbookdedication,visualnagpasanhiligartiststuladinjuryiguhitmasayang-masayawikataaspinakidalapagtangotelagiraykastilanakabiladmaglabatusongabigaelhinampasgownlandassiempresoccermasungitnamumukod-tangipinagkaloobannakakapamasyalenfermedades,laki-lakinaiinisikinakatwiranpamamasyalmusicianeskwelahankasalukuyankumbinsihinmakikiraanikinalulungkotnagmungkahikalalaronakaraaninilalabasnagpalalimnanahimikmiranasasabihanpanghihiyangmagpakasalkailanmanutusanbyggettahananyumaoskyldes,nakatitigmagtatanimarbularyopagsagotpamumunomagsusuotencuestasseguridadmahinakinalilibinganpagkuwanpangangatawantanggalinmatagpuanlalakisementeryobihiranglolausuarioenviarhinahanapculturesnatanongpinansintherapeuticsdalawaroofstockpaliparinkonsyertocramemangingisdanginhalesurveyspasaheparusahanikatlongbalik-tanawsurroundingsnaalislayuanquarantineeksportenpagkaingpagdaminakatinginreynailagayimpactsyorkdagatlayawtssskatapatkindsnahihilobukasracialhoysocialeaabotseniorexhaustedlookeditutolinterestsasthmacelularesdikyamnuhmatangcombatirlas,nalasingmalinismapadalirestawanbumugamabilisyoungdalawputahehydelnatingalaguronumerosaskabosesnasabinggreattakeslordblusangnakapuntagrinsmedidaharapniyansomdoingmakebituinhapasineditorinfinityplatformimpactedmenuuniquecallingmagsabistorymulacarerecentnerissahalika