Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "devices"

1. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

2. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

3. Oscilloscopes can be portable handheld devices or benchtop instruments with larger displays and advanced features.

4. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

5. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

6. We need to optimize our website for mobile devices to improve user experience.

Random Sentences

1. Walang kagatol gatol na sinagot ni Juan ang tanong ng kanyang teacher.

2. Cars, airplanes, and trains have made it possible for people to travel great distances in a relatively short amount of time

3. Hinintay ko siya sa labas ng kanyang opisina upang sabay kaming kumain ng hapunan dahil gustong-gusto ko siyang ligawan.

4. Ako ay nagtatanim ng mga orchids sa aking mga paso.

5. Scissors with serrated blades are useful for cutting through tough materials like cardboard or thick fabrics.

6. Las personas pobres a menudo enfrentan barreras para acceder a la justicia y la igualdad de oportunidades.

7. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

8. Las serpientes juegan un papel importante en el equilibrio de los ecosistemas al controlar las poblaciones de roedores.

9. Babalik ka pa ba? nanginginig na yung boses niya

10. Her decision to sponsor a child’s education was seen as a charitable act.

11. Magkaiba ang ugali nila, si Amparo ay tamad at walang kinagigiliwang gawin kundi ang lumapit sa mga bulaklak at amuyin ito.

12. Mag-babait na po siya.

13. Huwag magpabaya sa pagsunod sa mga patakaran at regulasyon sa trabaho.

14. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

15. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

16. At sa kanyang maninipis na labi, na bahagyang pasok sa pagkakalapat at maputla, ay naglalaro ang isang ngiti ng kasiyahan.

17. Sila ay nagpapakita ng dedikasyon sa paglilingkod sa kapwa at sa bayan.

18. The song went viral on TikTok, with millions of users creating their own videos to it.

19. Tinuruan ng lolo si Ben kung paano paliparin ang saranggola.

20. El teléfono también ha tenido un gran impacto en la forma en que las empresas se comunican con sus clientes

21. Malamig sa Estados Unidos kung taglagas.

22. Nationalism can also lead to xenophobia and prejudice against other nations and cultures.

23. Tantangan hidup juga dapat mengajarkan kita tentang nilai-nilai seperti kesabaran, rasa syukur, dan ketekunan.

24. Ang tubig-ulan ay maaaring magdulot ng mga masaganang pananim at halaman dahil sa pagtustos sa mga pangangailangan ng mga ito.

25. Ang buhay ay isang mumunting paraiso lamang.

26. Natutuwa ako sa magandang balita.

27. Hendes skønhed er ikke kun ydre, men også indre. (Her beauty is not just external, but also internal.)

28. Una de las obras más conocidas de Leonardo da Vinci es La Mona Lisa.

29. Musk was born in South Africa and later became a citizen of the United States and Canada.

30. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

31. Alam na niya ang mga iyon.

32. If you want to get ahead in your career, you have to put in the extra hours - the early bird gets the worm.

33. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

34. Dapat kong bilhan ng regalo si Maria.

35. Humahanga at lihim namang umiibig ang maraming kabinataan sa tatlong dalaga.

36. Hindi importante kung maganda o pangit ang itsura, ang mahalaga ay hindi kababawan ng kalooban.

37. Anong kailangan mo? pabalang kong tanong.

38. "Dogs are not our whole life, but they make our lives whole."

39. Hospitalization can be expensive, and patients may be responsible for paying for medical bills and other associated costs.

40. Punung-puno ng bunga ang puno, ngunit sobrang asim naman ng laman.

41. Napuyat ako kakapanood ng netflix.

42. El agua se utiliza en actividades recreativas, como la natación, el surf y la navegación.

43. Upang huwag nang lumaki ang gulo ay tumahimik na lang si Busyang, nagpatuloy naman sa pakikipagtagpo sa mayamang Don Segundo ang ambisyosang anak.

44. Naglalaway ang mga aso sa amoy ng pagkain na inilabas sa kusina.

45. Hindi ko inakala na magkakaroon ako ng ganitong pakiramdam, pero may gusto ako sa iyo.

46. Kung anong puno, siya ang bunga.

47. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

48. Ang tunay na kaibigan ay maasahan sa oras ng kagipitan.

49. Une alimentation équilibrée et une activité physique régulière sont des éléments clés pour maintenir une bonne santé.

50. Napatigil ako sa pagtawa ng seryoso nyang sinabi yun, Eh?

Recent Searches

devicesislapasswordmulti-billionmayolaborpromotingcardwealthplaysmesangdonelandonagingthroughoutmatangdancederendnothingboyetdollarglobaldownleukemiasobrapublishedjaneincreasinglyrhythmstarracialnakayukocountlessanothermuchoshellorelievedannamagbubungacompartenuponnasagutansumugodjuniolabanbowdebatesbinilipesosmonitorfinishedtransitactingenchantedgappacelargeamountmakingspreadinistvsconsidermultotindahanwhileoftentablebehaviorcontentuniquecharitablemanagersquatterblessbroadcastsbitawanboxrightferrersyncnakasalubongexamplesedentarythirdworkshopresultrangehatefistsclassroomhumpaykasakitwhetherleestudiedpakainmagworksasagutinunti-untinakatindig1876quicklyhampaslupalumiwanagnamumulaklakjobumilingflightmagkaibangmasayahinsurenaglokopahiramtumamiscorporationmalulungkotnasuklamtenerpaaralankalarotatlotaxibanalattorneymaisiprelativelypagkaawaumigtadiwanandisposaldomingolipadyanlegislativefearplayedibigmamanhikanyou,kinatatakutanwakasfacilitatingpedeindividualcallingcigarettesflexiblebumibitiwnagtatakbolibreeducationalaayusinnasundocontrolledresourcespamamasyalthankablefallalabisthreemagisingpagkaangatsaranggoladatinakatunghayprivatebarcelonamanamis-namismahawaantemparaturasimbahanpagpapasannakauponagtungopresidentialsalamangkeropagtitiponsasayawintobaccolumikhaluluwaspinag-aralanaanhinkatuwaanhouseholdssukatpagkatakotpronounnahihilomahiwaganahintakutaniigibtatagalleksiyonphilanthropykulungannapatigil