Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "interests"

1. Effective representatives possess strong communication, leadership, and negotiation skills to effectively represent their constituents' interests.

2. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

3. He pursued an "America First" agenda, advocating for trade protectionism and prioritizing domestic interests.

4. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

5. It's important to be realistic about your expectations and to choose a strategy that aligns with your skills and interests

6. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

7. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

8. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

9. The TikTok algorithm uses artificial intelligence to suggest videos to users based on their interests and behavior.

10. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

11. They engage in debates and discussions to advocate for their constituents' interests and advance their agendas.

12. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

13. Women have diverse interests and hobbies, from sports and fitness to travel and cooking.

Random Sentences

1. Der er mange traditionelle ritualer og ceremonier forbundet med at blive kvinde i forskellige kulturer.

2. Mi amigo es muy bueno con las palabras y siempre me ayuda con mis discursos.

3. Kumain ako ng itlog kaninang umaga.

4. Mahalaga ang papel ng edukasyon sa pagpapalawig ng kaalaman at oportunidad para sa sektor ng anak-pawis.

5. Uy, malapit na pala birthday mo!

6. Ada udang di balik batu.

7. Ahh Mommy, anong oras ba yung flight mo? tanong ni Maico.

8. Hindi ko alam kung nagbibiro siya.

9. The information might be outdated, so take it with a grain of salt and check for more recent sources.

10. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

11. Ang mga mamamayan sa mga lugar na mayaman sa tubig-ulan ay dapat mag-ingat sa pagtatapon ng basura upang maiwasan ang pagbabara ng mga daluyan ng tubig.

12. Ang republika na itinatag niya ang unang demokratikong republika sa Asya.

13. Nagbigay ako ng tulong sa mga nangangailangan kaya masayang-masaya ako ngayon.

14. Ang panitikan ay nagpapahayag ng mga damdamin at karanasan ng mga tao, at ito ay isang paraan ng pag-awit ng kanilang mga kuwento.

15. Masamang droga ay iwasan.

16. Maarte siya sa mga kainan kaya hindi siya mahilig sa mga fast food chain.

17. Mon fiancé et moi avons choisi nos alliances ensemble.

18. Sa hirap ng buhay, ang aking kabiyak ay ang aking kakampi at kasama sa pagtahak ng mga hamon.

19. Paano mo pinalambot ang giniling na karne?

20. Scientific research has shown that regular exercise can improve heart health.

21. Inflation kann dazu führen, dass Unternehmen Schwierigkeiten haben, Kredite zu erhalten.

22. Nahihilo ako dahil masyadong maalog ang van.

23. Bagaimana pendapatmu tentang film yang baru saja tayang? (What is your opinion on the latest movie?)

24. Indonesia dikenal dengan pantai-pantainya yang indah dan airnya yang jernih, seperti Bali, Lombok, dan Gili Islands.

25. May nakita akong matandang nag-aalok ng pulotgata sa palengke.

26. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

27. Ang tahanan ng mga ibon sa tabi ng ilog ay mayabong at nagbibigay ng malasakit sa kalikasan.

28. Les étudiants sont encouragés à poursuivre des activités de bénévolat pour développer leurs compétences en leadership.

29. Hindi dapat natin husgahan agad ang mga taong bukas palad sa kanilang buhay dahil baka sila pa ang tunay na maligaya.

30. La música también es una parte importante de la educación en España

31. Computer vision is another field of AI that focuses on enabling machines to interpret and analyze visual data.

32. Ang marahas na paggamit ng teknolohiya, tulad ng cyberbullying, ay dapat itigil at parusahan.

33. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

34. Makapangyarihan ang salita.

35. There were a lot of boxes to unpack after the move.

36. Hindi ko na kayang panindigan ang aking pagkatao dahil sa inis na nararamdaman ko.

37. Magdamag kong naiwang bukas ang ilaw.

38. Nakarating na kami sa aming pupuntahan.

39. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

40. He is not having a conversation with his friend now.

41. Børns mentale sundhed er lige så vigtig som deres fysiske sundhed.

42. Accepting the job offer without reading the contract was a risky decision.

43. Magkakaroon umano ng libreng bakuna sa susunod na buwan ayon sa DOH.

44. Waring hindi siya sang-ayon sa desisyon ng grupo, ngunit hindi niya ito ipinakita.

45. Nagpaluto ako ng adobo sa nanay ko.

46. Los agricultores a menudo trabajan en estrecha colaboración con otros miembros de la cadena alimentaria, como los transportistas y los minoristas.

47. Our transport systems-diesel-run railways, steamships, motor vehicles, and aeroplanes-all constantly need natural fuel to keep on moving

48. Alam ko na hindi maganda ang agam-agam ko, kaya kailangan kong magsumikap upang malunasan ito.

49. Gumawa si Mario ng maliit na bola mula sa papel.

50. Ang mga puno at halaman ay nag po-produce ng oxygen.

Similar Words

interests,

Recent Searches

bayaniinterestsanumangpartbeinteyatajanemisteryopataynagpapaniwalaibinubulongpinaulanankinatatayuanasahanibinilikinainhaydaanadvanceomgdevelopedngpuntagitnapakilutopaskoxixnagsilapithugisaabotnagkapilatpookreservationmagsabikisapmatasakalingboyfriendnanghahapdimaabutanplatonabalitaandurantemaliksinagawangkumbinsihinlungsodmakapangyarihaniilannakikini-kinitavehiclespicsmagasawangroofstockromanticismoaanhinpinapalobanlaginlovekasangkapanskirtpronounipapainitlumbaytalentbusykaliwabumilivalleyeasiernakatuonpalakanakapagngangalitnakarinigpagngitigawinsumusulatforskel,limitfredflamenconammagkanoginugunitamagisingnatayotatagalnakapuntatumatanglawnaghilamosmayofamekapit-bahaynagmistulangumagangpaliparinorganizeyelokaharianpaglingonnanunuksocompleteofficenanaymakaraanmagbalikpagbabayadumiyaknumerosaslabastakepangangatawandinggininilabasmabilispollutionbilibidpinakamaartengnapipilitanabut-abotmasterbwisitlaganappublishedmanahimikadvancedsequewifiperoiyoelectionsdeliciosakampanasalattekstpostersumalakaytransmitidasnagpagupitoutlinesnowtatanggapiniinuminestatealleproducekuwadernoyoutube,filmnakasahodkasamaangpanayparinnakaka-innakalagaysalesnakataaslamigmagtigilfinishednakatagokinatatakutannapaiyakyamantabimayamangfaceayokoinabutannakilalapagdukwangninongkumitaviolencecompanykumananumigtadhinagisimbeslightscleartilatelevisednapakoisinagotkumantamaskkingdomarmedguiltymanghikayatbobotodapit-haponbaduyschedulethroughoutcoughingdecreasedcharitablebinge-watchingtumatawadiwanan