Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

27 sentences found for "tener"

1. Debemos tener una buena comprensión de la realidad para tomar decisiones informadas.

2. Durante el invierno, es importante tener un buen sistema de calefacción en el hogar para mantenerse caliente.

3. El nacimiento de un bebé puede tener un gran impacto en la vida de los padres y la familia, y puede requerir ajustes en la rutina diaria y las responsabilidades.

4. Es importante ser honestos con nosotros mismos para tener una buena conciencia.

5. Es importante tener amigos que nos apoyen y nos escuchen.

6. Es importante tener en cuenta la privacidad y la seguridad al utilizar las redes sociales.

7. Es importante tener en cuenta que el clima y el suelo son factores importantes a considerar en el proceso de cultivo del maíz

8. La letra de una canción puede tener un gran impacto en la audiencia.

9. Las drogas pueden tener efectos devastadores en la vida de las personas.

10. Las escuelas también pueden tener una biblioteca y recursos educativos en línea para los estudiantes.

11. Las plantas suelen tener raíces, tallos, hojas y flores, cada una con una función específica.

12. Los desastres naturales, como las inundaciones y sequías, pueden tener un impacto significativo en el suministro de agua.

13. Los héroes pueden tener habilidades sobresalientes, pero también muestran compasión y empatía hacia los demás.

14. Los padres pueden elegir tener un parto en casa o en un hospital, dependiendo de sus preferencias y necesidades.

15. Los powerbanks suelen tener puertos USB que permiten conectar diferentes tipos de dispositivos.

16. Los powerbanks también pueden tener características adicionales, como indicadores LED que muestran el nivel de carga.

17. Mi sueño es tener éxito en mi pasión por la moda y el diseño. (My dream is to succeed in my passion for fashion and design.)

18. Mi sueño es tener una familia feliz y saludable. (My dream is to have a happy and healthy family.)

19. Quiero tener éxito en mi carrera y alcanzar mis metas profesionales. (I want to succeed in my career and achieve my professional goals.)

20. Siempre hay que tener paciencia con los demás.

21. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

22. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

23. Sueño con tener un estilo de vida saludable y activo. (I dream of having a healthy and active lifestyle.)

24. Tendremos que tener paciencia hasta que llegue nuestro turno.

25. Tengo que tener paciencia para lograr mi objetivo.

26. Tienes que tener paciencia para lograr buenos resultados.

27. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

Random Sentences

1. Einstein's scientific work was heavily influenced by his philosophical and moral beliefs.

2. Musk has been vocal about his concerns over the potential dangers of artificial intelligence.

3. Ano ho ang gusto ninyong bilhin?

4. Sa panahon ngayon, napakahalaga ng mga taong bukas palad dahil sila ang nagbibigay ng pag-asa sa mga taong nangangailangan.

5. Inakalang mahal siya ng kasintahan, pero hindi pala.

6. The film director produced a series of short films, experimenting with different styles and genres.

7. Di natagalan, isinawak niya ang kamay sa nalalabing tubig sa balde.

8. She does not skip her exercise routine.

9. Marami nang nakapaligid sa kanila, mga batang nagtitinda, lalaki at babaing mamimili.

10. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

11. Ang pangalan niya ay Ipong.

12. The website's security features are top-notch, ensuring that user data is protected from cyber attacks.

13. Napakamot na lang ng ulo si Kenji.

14. Nagsusulat ako ng mga pangaral at talumpati para sa mga okasyon sa paaralan.

15. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

16. Nagtagal ang sakit ni Aling Rosa kaya't napilitang si Pinang ang gumagawa sa bahay.

17.

18. Kucing di Indonesia sering diberi nama dengan arti yang unik dan lucu.

19. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

20. We sang "happy birthday" to my nephew over video chat.

21. Det kan omfatte spil som kasinospil, lotteri, sportsbetting og online spil.

22. Yan ang totoo.

23. Maramot ang kapitbahay nila at hindi nagpapahiram ng gamit kahit kailan.

24. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

25. Ang oxygen ay kailangan ng tao para mabuhay.

26. The Colosseum in Rome is a remarkable wonder of ancient Roman architecture.

27. Ang poot ay nagiging tagapagtanggol ko sa sarili ko, isang apoy na umaalab sa aking loob upang ipagtanggol ang aking pagkatao.

28. Lending money to someone without collateral is a risky endeavor.

29. Ugali mo panget! Bitawan mo nga ako! Sisipain na kita!

30. Ang tunay na kaibigan, sa hirap at ginhawa ay kasama.

31. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

32. Who are you calling chickenpox huh?

33. Put all your eggs in one basket

34. Emphasis is an important component of artistic expression, such as in poetry and music.

35. Denne kombination har vist sig at være meget effektiv i at skabe en høj grad af velstand og velfærd for befolkningen

36. Mahalaga na magkaroon tayo ng mga pangarap upang maabot natin ang ating mga layunin.

37. Magpupunta kami ng hospital mamaya upang magpa-checkup.

38. A lot of traffic on the highway delayed our trip.

39. Inumin mo ang gamot nang minsan isang araw.

40. Bakit siya ginaganoon ni Ogor?

41. It's so loud in here - the rain is coming down so hard it's like it's raining cats and dogs on the roof.

42. Emphasis can help to ensure that a message is received and understood by the intended audience.

43. She exercises at home.

44. Matapos ng ilang araw ito ay namulaklak.

45. Ano-ano ang mga projects nila?

46. Maskiner er også en vigtig del af teknologi

47. Naging malilimutin si Carla mula nang magkasakit siya.

48. Sa paglutas ng mga palaisipan, mahalaga ang pagkakaroon ng tamang pag-iisip, kaalaman, at tiyaga.

49. Nakakatakot ang kanilang lugar sapagkat andaming adik.

50. Sandali na lang.

Similar Words

obtener

Recent Searches

tenermiyerkolesparaisosang-ayonsiksikannagkasunogsinapitmalapitanmagsisinemumuntingmag-ibaofrecenunderholdermahuhusayagam-agamhanginlasingeroculturetaospagtawareceptormakulitnakapaligidcrucialbagalculturasspeechespinaghatidancontentkuwentoincludeeksperimenteringumiimikmagpakaramisapilitangsakalingmatipunopamamagitanmagisiptasanakasandigsumpainbinibilikunwapresleynochesakimteachertanganindependentlyheartbreaknyanaddictionnegosyobarrocookaynoblemangingisdaditobotantearguenilajacenitongrhythmwowadvancesoliviaipagbilimapaikotmapuputileegcigarettessupilinavailablemakabangonmakapaghilamosdatimarsogarbansosipakitapedengdahonnayonsusundohospitalfraisinilangarkilanatutuwapaghangarelomahulogmapa,bangarestdaratingauthorelectronicjoypdakapamilyacasesstreamingindividualshulinggenerationsdeclarenapatawagnag-iinompresidentialnagtatampopagpasensyahanpapagalitannapapalibutankaloobangnagkakasyapulang-pulaalas-diyesnakakagalamakahirameskwelahannagpaalamkayohulunakatindigpansamantalafilipinainvestpwedengpambahaynahintakutanmagselosmonsignorumiinompinigilanmagbibiladnangyarimagkasamamagsasakadisfrutararaw-arawpinabulaananginiirogchartsbarnesgumigisingpakukuluanmasaktantumigilkolehiyomaanghangtinatanongmismoculturesisinusuotbinentahangawaintinderalamanglikuranwatawatadvancementpansinberegningertemperaturapagbigyankaninopamagattagaroonartekumakalansingalagangkumunothagdanrenombrepakinabanganpaosgubatthanksgivingathenaconvey,mississippiexpresangymgrewumokayiyaknenabritishmaaaringnag-aaralnagmamadalitumulakhumiwalaypagsusulitpalitantusongparaangdesign,