Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

27 sentences found for "tener"

1. Debemos tener una buena comprensión de la realidad para tomar decisiones informadas.

2. Durante el invierno, es importante tener un buen sistema de calefacción en el hogar para mantenerse caliente.

3. El nacimiento de un bebé puede tener un gran impacto en la vida de los padres y la familia, y puede requerir ajustes en la rutina diaria y las responsabilidades.

4. Es importante ser honestos con nosotros mismos para tener una buena conciencia.

5. Es importante tener amigos que nos apoyen y nos escuchen.

6. Es importante tener en cuenta la privacidad y la seguridad al utilizar las redes sociales.

7. Es importante tener en cuenta que el clima y el suelo son factores importantes a considerar en el proceso de cultivo del maíz

8. La letra de una canción puede tener un gran impacto en la audiencia.

9. Las drogas pueden tener efectos devastadores en la vida de las personas.

10. Las escuelas también pueden tener una biblioteca y recursos educativos en línea para los estudiantes.

11. Las plantas suelen tener raíces, tallos, hojas y flores, cada una con una función específica.

12. Los desastres naturales, como las inundaciones y sequías, pueden tener un impacto significativo en el suministro de agua.

13. Los héroes pueden tener habilidades sobresalientes, pero también muestran compasión y empatía hacia los demás.

14. Los padres pueden elegir tener un parto en casa o en un hospital, dependiendo de sus preferencias y necesidades.

15. Los powerbanks suelen tener puertos USB que permiten conectar diferentes tipos de dispositivos.

16. Los powerbanks también pueden tener características adicionales, como indicadores LED que muestran el nivel de carga.

17. Mi sueño es tener éxito en mi pasión por la moda y el diseño. (My dream is to succeed in my passion for fashion and design.)

18. Mi sueño es tener una familia feliz y saludable. (My dream is to have a happy and healthy family.)

19. Quiero tener éxito en mi carrera y alcanzar mis metas profesionales. (I want to succeed in my career and achieve my professional goals.)

20. Siempre hay que tener paciencia con los demás.

21. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

22. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

23. Sueño con tener un estilo de vida saludable y activo. (I dream of having a healthy and active lifestyle.)

24. Tendremos que tener paciencia hasta que llegue nuestro turno.

25. Tengo que tener paciencia para lograr mi objetivo.

26. Tienes que tener paciencia para lograr buenos resultados.

27. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

Random Sentences

1. Electric cars are available in a variety of models and price ranges to suit different budgets and needs.

2. La science est la clé de nombreuses découvertes et avancées technologiques.

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. Bumili si Ana ng regalo para sa asawa.

5. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

6. Iba ang landas na kaniyang tinahak.

7. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

8. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

9. Pupunta si Trina sa Baguio sa Oktubre.

10. Nahuli na ang salarin sa kasong pagnanakaw.

11. Las serpientes tienen una mandíbula flexible que les permite tragar presas enteras, incluso si son más grandes que su propia cabeza.

12. He sought to strengthen border security and pushed for the construction of a border wall between the United States and Mexico.

13. This has led to increased trade and commerce, as well as greater mobility for individuals

14. Hindi dapat natin hayaang mayroong paglapastangan sa mga pangalan ng mga namayapa.

15. Laking galak nito nang matagpuan ang maraming itlog ng bayawak, at tuwang-tuwa na tinirador ang mga itlog.

16. Hindi niya iningatan ang kanyang cellphone, samakatuwid, nasira ito agad.

17. Bigla, ubos-lakas at nag-uumiri siyang umigtad.

18. Hinde sa ayaw ko.. hinde ko lang kaya..

19. They have already finished their dinner.

20. Sumimangot siya bigla. Hinde ako magpapapagod.. Pramis.

21. Dumalaw si Ana noong isang buwan.

22. He was known for his active and controversial presence on social media, particularly Twitter.

23. All these years, I have been learning to appreciate the present moment and not take life for granted.

24. La pobreza afecta no solo a las personas, sino también a las comunidades enteras.

25.

26. Menjaga hubungan yang harmonis dan menyenangkan dengan orang-orang di sekitar kita dapat meningkatkan kebahagiaan dan kepuasan hidup.

27. Dahil sa matinding ulan, nasira ang aming picnic at ikinakalungkot namin ito.

28. Isang araw sa kanyang pamamasyal ay may nakilala siyang isang bagong mukha.

29. Nakuha niya ang mataas na grado sa pagsusulit, bagkus hindi siya gaanong nag-aaral ng mabuti.

30. May kinuha sya sa backpack nya, Dapat gumagamit ka nito.

31. The platform offers various filters and editing tools to enhance the appearance of photos before posting.

32. Mahusay talaga gumawa ng pelikula ang mga korean.

33. Aba oo, yun lang pala, nakakunot-noong sagot ni Kablan.

34. Kapansin-pansin ang dami ng mga insekto na naglipana sa gabi.

35. Der er mange forskellige former for motion, herunder aerob træning, styrketræning og fleksibilitetstræning.

36. Miguel Ángel murió en Roma en 1564 a la edad de 88 años.

37. Football is known for its intense rivalries and passionate fan culture.

38. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

39. Ang tunay na kaibigan, sa hirap at ginhawa ay kasama.

40. Este aderezo tiene un sabor picante y cítrico que lo hace delicioso.

41. Laganap ang paggamit ng social media sa kabataan ngayon.

42. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

43. Hindi ko kaya itago ang aking damdamin, kaya sana pwede ba kita ligawan?

44. There were a lot of people at the concert last night.

45. Mahal ang mga bilihin sa Singapore.

46. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

47. Para sa anak ni Consuelo ang T-shirt.

48. Les motivations peuvent changer au fil du temps, et il est important de s'adapter à ces changements pour rester motivé.

49. Sinakop ng mga espanyol ang Pilipinas nang mahigit sa 300 years.

50. Lalong pinagsikapan ng paring Kastila ang pagtuturo ng buhay at mga aral ni HesuKristo.

Similar Words

obtener

Recent Searches

kumaliwanakakarinigtenersuzettekapaglackhimigtherapeuticsknightanghelhistorynapilingibabawalapaapumanoduwendenamuhaykare-karesineoporeservednagtakatingingpangitnagtalagabutasmay-ariworkconvertidasdemocracynakuhatagtuyotpalitansampungmassachusettsgusalictricasdealumuponobodymaibigaylabikirbyipinalitilingstartedcornerwhyinternaagenasisiyahanbringdollarimprovengitipoginagagandahankasalukuyanpinag-usapanmakapaibabawmagkikitanagkakatipun-tiponnakakapagpatibayoktubrepaglapastanganmanggagalingnapaluhakalayaankasangkapannakatirangkonsentrasyonressourcernenakakatulongpinapakiramdamannangyarihumiwalaybefolkningen,panghihiyangopgaver,inilalabasbumisitaenergy-coalnanlilisikmabigyanmakipag-barkadanakabawipaghaharutanmagtataasmumuntingumiinomromanticismomagsi-skiingmedisinamahuhusaynanlalamigkinalilibinganincluirnagagamitnalalabingkidkiranengkantadangmahinangnaapektuhantanggalinforskel,napapadaantuktoknalugodfrancisconatabunannagdabognatatawakolehiyomaanghangsinusuklalyanmanakbohinamakkabighapinangaralannagbibigayanmilyongisinaboypundidolumagokulotwaiteralakbaryotasarolandbuwayasabogkaniyanababalotprobinsyaadditionally,risecarbondeletingcompositoreskriskatsuperexpresanfe-facebooknararapatcongressmanuksokasonicotagalogmangehetopataydalagangwasakaffiliateingatanwarigrinskabosesparomedidajosemansanaslikessinumangagostokumapitsanandamingbataypopcornexcusenoosenateyepmakisigsalabeinteagoshallpakpakflexiblescientistabiamongroonritwalcigarettesfacilitatingfatalellentrackgenerationerinalisspafindputahegamebundok