Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "dinalaw"

1. Tatlong araw bago dumating ang ikatlong Sabado, sorpresa ko siyang dinalaw.

Random Sentences

1. Para cosechar las almendras, primero se deben sacudir los árboles con cuidado.

2. Si Dr. John ay isang doktor sa kanilang baryo.

3. Guten Abend! - Good evening!

4. Når man bliver kvinde, åbner der sig mange nye muligheder og udfordringer.

5. Pour maintenir sa motivation, il est important d'avoir des objectifs clairs et réalisables.

6. Maraming tao ang nagpaplastikan sa harap ng ibang tao para lang mapasama.

7. Ang mga bayani ay nagtutulungan upang maipagtanggol ang bayan laban sa mga banta at kahirapan.

8. Matapos mabasag ang aking paboritong gamit, hindi ko napigilang maglabas ng malalim na himutok.

9. Ang tunay na pag-ibig sa bayan, ay sa sariling wika nagsisimula.

10. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

11. No hay palabras suficientes para agradecer tu amor y apoyo.

12. Las hojas de los árboles cambian de color en otoño.

13. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

14. Nagpaluto ako ng adobo sa nanay ko.

15. El accidente produjo un gran tráfico en la carretera principal.

16. The presentation was absolutely flawless; you did a great job.

17. Les écoles travaillent à fournir un environnement d'apprentissage sûr et inclusif pour tous les étudiants.

18. Nauna na palang kausapin ni Cupid si Apollo kaya naman siya ang itinakdang mapangasawa ni Pysche.

19. Gusto mo ba ng mainit o malamig na kape?

20. Scientific experiments have shown that plants can respond to stimuli and communicate with each other.

21. Ang mga tao ay nasiyahan sa nangyari.

22. Nasaan si Trina sa Disyembre?

23. Napatungo ako dahil nangingilid na naman ang mata ko.

24. Con permiso ¿Puedo pasar?

25. Smoking is influenced by various factors, such as peer pressure, stress, and social norms.

26. Ang payat at namumutla ang dalaga kaya nag-alala ang binata.

27. He blew out the candles on his birthday cake and made a wish.

28. Women have faced discrimination and barriers in many areas of life, including education and employment.

29. Nakalimutan ko na ang pakiramdam ng hindi paghahanda sa agaw-buhay na pag-ibig.

30. Frustration can be caused by external factors such as obstacles or difficulties, or by internal factors such as lack of skills or motivation.

31. Working can provide a sense of purpose, achievement, and fulfillment.

32. La moda de usar ropa estrafalaria está llamando la atención de los jóvenes.

33. Walang sinasabi ang mga ito, ngunit sa mga mata, sa galaw ng mga labi nababasa nya ang isinisigaw ng mga paslit.

34. Las plantas proporcionan oxígeno y son esenciales para mantener el equilibrio ecológico.

35. At forfølge vores drømme kan kræve mod og beslutsomhed.

36. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

37. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

38. Puwede ho ba akong lumipat ng kuwarto?

39. Lee's influence on the martial arts world is undeniable

40. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

41. Hintayin mo ko.. Kahit anong mangyari hintayin mo ko..

42. Nasa sala ang telebisyon namin.

43. Malaki ang lungsod ng Makati.

44. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

45. Sa Sabado, alas-diyes ng umaga.

46. Hindi niya iningatan ang kanyang cellphone, samakatuwid, nasira ito agad.

47. Nagsisilbi siya bilang pari upang magbigay ng espirituwal na tulong sa kanyang mga parokyano.

48. Me gusta comprar chocolates en forma de corazón para mi novio en el Día de San Valentín.

49. Ipaghugas mo siya ng mga Maghugas ka ng mga

50. Limitations can be a result of geographic location or access to resources and opportunities.

Recent Searches

dinalawmanuscriptmodernsinunodclasessnobbangbeinteperlastaradditionlimospagbahingmightisugamahulogfacultyinfluencegotthemprovidedipongboylayout,pag-indakinsteadwhethergeneratedskillandremakespersistent,contentinulitupoyangclienteanongalexanderpumapasoknauwihealthierreserbasyonmakapagsabimahiwaganakasakitpinapataposkulunganhagdananlever,masyadongculturesmismomaliitproducetaosneedgayundinpapalapitmatandangbuhoksikiphinugottokyopagkakatumbamagnifycardmalinissumapitsinceautomatiskhouseholdibinaonmabatongmagdaraoshusopambatangkikitagamestabioutpostipinabalikbagotherscryptocurrency:magpasalamattabing-dagatkahalumigmiganpagkalungkotnalalamanmakakasahodmagpaniwalanagliliwanaggobernadormateryalesnakasahodkumikinigkagandahannagpipiknikmeriendamensajestig-bebentenaghuhumindigkamandagrevolutionereteskwelahandostumikimnakalocktumawaalapaapnakataasmedisinanaguguluhankalayuanminamahalmakapalagnaghihirappagdudugokwartohouseholdsihahatidaffiliatejosiehonestoisusuotsapatoskisapmatamasanayminahanbumagsakhumihingigawingpagmasdaniniresetanaabotradyonakarinigbinuksantibokallelubosmalasutlaloribibilhinsinagotkainisreynamaatimtamadtsinelasnapakatakawiniindaelenaculpritbinibilangpulitikobobotopinataymartespakilutohundredilocossundaecultivationpearldreamiikli1929bingoprutasmayoconnectingknownritoinantokhangaringelectionsbillreducedpumuntawidespreaddagalapatdemocraticdatiyearssusunduinanimoguiltydarkdirectfuncionarresultpollutionnaglokobituinfuturegapbiling