Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

38 sentences found for "various"

1. Ailments can be caused by various factors, such as genetics, environmental factors, lifestyle choices, and infections.

2. Baby fever can affect people of various ages, backgrounds, and genders.

3. Cancer patients may receive support from various healthcare professionals, such as oncologists, nurses, and social workers.

4. Cheating can be caused by various factors, including boredom, lack of intimacy, or a desire for novelty or excitement.

5. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

6. Cryptocurrency exchanges allow users to buy, sell, and trade various cryptocurrencies.

7. Electric cars can be charged using various methods, including home charging stations, public charging stations, and fast charging stations.

8. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

9. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

10. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

11. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

12. Holy Week is observed by Christians around the world, with various traditions and customs associated with each day.

13. I like how the website has a blog section where users can read about various topics.

14. It is a versatile dish that can be customized with various fillings and toppings.

15. Lazada offers various payment options, including credit card, bank transfer, and cash on delivery.

16. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

17. Money can be earned through various means, such as working, investing, and entrepreneurship.

18. Musk has been involved in various controversies over his comments on social and political issues.

19. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

20. Oscilloscopes have various controls, such as vertical and horizontal scaling, timebase adjustments, and trigger settings.

21. Representatives can be found at various levels of government, such as local, regional, national, or international.

22. Scissors are commonly used in various industries, including arts and crafts, sewing, hairdressing, and cooking.

23. Smoking can cause various health problems, including lung cancer, heart disease, and respiratory issues.

24. Smoking is influenced by various factors, such as peer pressure, stress, and social norms.

25. Tesla has expanded its operations globally, with presence in various countries and plans for further expansion.

26. The belief in God is widespread throughout human history and has been expressed in various religious traditions.

27. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

28. The dedication of scientists and researchers leads to groundbreaking discoveries and advancements in various fields.

29. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

30. The Jungle Book introduces Mowgli, a young boy raised by wolves, as he encounters various jungle animals and learns life lessons.

31. The Lakers have a strong philanthropic presence in the community, supporting various charitable initiatives and organizations.

32. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

33. The onset of baby fever can be triggered by various factors, such as seeing a newborn, spending time with young children, or witnessing others in their parenting journey.

34. The patient's prognosis for leukemia depended on various factors, such as their age, overall health, and response to treatment.

35. The platform offers various filters and editing tools to enhance the appearance of photos before posting.

36. Trump implemented various policies during his tenure, including tax cuts, deregulation efforts, and immigration reforms.

37. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

38. Women have made significant strides in breaking through glass ceilings in various industries and professions.

Random Sentences

1. Ang ganda ng bagong laptop ni Maria.

2. Masarap magluto ng midnight snack sa hatinggabi kapag nagugutom ka.

3. Paano po kayo naapektuhan nito?

4. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

5. Sa takip-silim, maaari kang mapakali at magpakalma matapos ang isang mahabang araw.

6. Nakita nilang ang balat ng bunga ay manipis at maliit ang buto.

7. Kailangan kong hiramin ang iyong pliers para sa aking proyektong DIY.

8. Hindi dapat umutang nang labis sa kakayahan ng pagbabayad upang maiwasan ang pagkakaroon ng financial burden.

9. Bukas na pala ang araw ng kalayaan.

10. Lalo itong nalungkot nang malamang magdaraos ng isang handaan ang Adang kagubatan.

11. Isinuot niya ang kamiseta.

12. Promise babayaran kita in the future. sabi ko sa kanya.

13. Kinapanayam siya ng reporter.

14. The baby is sleeping in the crib.

15. Isa daw siyang mabangis na hayop dahil tulad nila meron din siyang matatalim na mga pangil.

16. Dialog antaragama dan kerja sama antarumat beragama menjadi penting dalam membangun perdamaian dan keharmonisan di tengah keragaman agama.

17. Lumago ang halaman, yumabong ang sanga hanggang sa ito'y namulaklak at namunga.

18. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

19. Setelah kelahiran, calon ibu dan bayi akan mendapatkan perawatan khusus dari bidan atau dokter.

20. Ngayon ka lang makakakaen dito?

21. Sa panitikan, maaari nating makilala ang mga kilalang manunulat ng bansa.

22. Helte kan være en kilde til inspiration og motivation.

23. Hindi ko man masabi sa iyo nang harapan, pero crush kita nang sobra-sobra.

24. Nagbabaga ang hangarin ng mga kabataan na magtagumpay sa kabila ng mga hamon.

25. Museum Nasional di Jakarta adalah museum terbesar di Indonesia yang menampilkan berbagai koleksi sejarah dan budaya Indonesia.

26. The king's legacy may be celebrated through statues, monuments, or other memorials.

27. Børn bør lære at tage ansvar for deres handlinger og træffe gode beslutninger.

28. Maundy Thursday is the day when Jesus celebrated the Last Supper with his disciples, washing their feet as a sign of humility and love.

29. Lazada is headquartered in Singapore and has operations in Indonesia, Malaysia, the Philippines, Singapore, Thailand, and Vietnam.

30. Babyens første skrig efter fødslen er en betydningsfuld og livgivende begivenhed.

31. Tumawag ako kaninang umaga pero wala ka.

32. Ikaw ang bumitaw! hila-agawan ang ginagawa namin.

33. Sana maintindihan mo kung bakit ako nagagalit at nag-iinis sa iyo.

34. Gracias por entenderme incluso cuando no puedo explicarlo.

35. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

36. The acquired assets will be a valuable addition to the company's portfolio.

37. Mahalaga ang listahan para sa mga malilimutin tulad ni Lita.

38. Walang tutulong sa iyo kundi ang iyong pamilya.

39. AI algorithms can be used in a wide range of applications, from self-driving cars to virtual assistants.

40. En la realidad, no hay atajos para alcanzar el éxito.

41. Meskipun tantangan hidup kadang-kadang sulit, tetapi mereka juga dapat memberikan kepuasan dan kebahagiaan ketika berhasil diatasi.

42. Sasambulat na ang nakabibinging tawanan.

43. It's important to provide proper nutrition and health care to pets.

44. Ang bata ay na-suway sa kanyang magulang nang hindi sumunod sa kautusan.

45. Ada berbagai jenis kucing yang ada di Indonesia, seperti kucing Persia, Siamese, dan Scottish Fold.

46. Nagbakasyon kami sa tabi ng karagatan noong tag-init.

47. I heard that he's not trustworthy, so I take everything he says with a grain of salt.

48. La esperanza es el combustible que nos impulsa a seguir adelante cuando todo parece perdido. (Hope is the fuel that drives us forward when all seems lost.)

49. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

50. Hindi ba nagdaramdam ang nanay at tatay mo?

Recent Searches

variousdaddyparatingeasycomputerdekorasyoncontinuetandangmagagosexistuloaffectsutilentrymulingmanagerendingheftysetsanungvidtstraktnapakamotnasasaktanmatulunginrenaiapulongforcessulinganayawpagtatakacornersnakabilimawalananghihinatelephonecardiganpesonagtungonapapalibutanpinagalitannakapapasongnalalaglagnagpakitanagmamaktolnakakatawaeskuwelahannaglalatangaanhinnagkasunogpagpapautangibinubulongnapaluhadisciplinmakakawawamagkaparehokanikanilangkubyertoskamakailanmakatatlominamahalkapamilyamagbabagsikmahiwagangpagkabuhaypalaisipanpanalanginmagkakaroonphilanthropysundalomaipapautangbrancher,perpektingbingipalamutiibinaonkadalasfactoresmabatongdropshipping,nakabibingingsalbahengtahananlandasjulietuniversitiesmaibigaynakabaoneksport,rewardingmakisuyoemocionesmagpakaraminapakalamigvedtamarawlolanatitiyaktungomatumalorkidyasumangatpinansininaabottutusinbandaseryosongkanilaandreahihigitbiglaanmaghapongincrediblegrocerykaraokekinakabahantusongnakainnatakotpagpasokpatongasawaganyanumigiblittlemalasutlanakabiladnuevokinahuhumalinganbayaningtanganmarilounilapitanipagmalaakitawanantondomamarilanumannilalangflamencothroatsagotganitoraciallalongreynamaghahandaguroyoutubeisinumpajobsinasolasiatickatapatisamamatigasnamainiintaynatulogwifihotelarkilamayamangasthmaarguegoalkinantahumblepssstambayankindsmaidbulakimageskakayananggeneeuphoricnagbasaharapkommunikerergrinsalexandersipadahaniatfnakasuotsigafuelmasseslamanpopularizehusobecoming1787effektiv1929nasabingmahahabamedieval