Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

38 sentences found for "various"

1. Ailments can be caused by various factors, such as genetics, environmental factors, lifestyle choices, and infections.

2. Baby fever can affect people of various ages, backgrounds, and genders.

3. Cancer patients may receive support from various healthcare professionals, such as oncologists, nurses, and social workers.

4. Cheating can be caused by various factors, including boredom, lack of intimacy, or a desire for novelty or excitement.

5. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

6. Cryptocurrency exchanges allow users to buy, sell, and trade various cryptocurrencies.

7. Electric cars can be charged using various methods, including home charging stations, public charging stations, and fast charging stations.

8. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

9. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

10. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

11. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

12. Holy Week is observed by Christians around the world, with various traditions and customs associated with each day.

13. I like how the website has a blog section where users can read about various topics.

14. It is a versatile dish that can be customized with various fillings and toppings.

15. Lazada offers various payment options, including credit card, bank transfer, and cash on delivery.

16. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

17. Money can be earned through various means, such as working, investing, and entrepreneurship.

18. Musk has been involved in various controversies over his comments on social and political issues.

19. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

20. Oscilloscopes have various controls, such as vertical and horizontal scaling, timebase adjustments, and trigger settings.

21. Representatives can be found at various levels of government, such as local, regional, national, or international.

22. Scissors are commonly used in various industries, including arts and crafts, sewing, hairdressing, and cooking.

23. Smoking can cause various health problems, including lung cancer, heart disease, and respiratory issues.

24. Smoking is influenced by various factors, such as peer pressure, stress, and social norms.

25. Tesla has expanded its operations globally, with presence in various countries and plans for further expansion.

26. The belief in God is widespread throughout human history and has been expressed in various religious traditions.

27. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

28. The dedication of scientists and researchers leads to groundbreaking discoveries and advancements in various fields.

29. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

30. The Jungle Book introduces Mowgli, a young boy raised by wolves, as he encounters various jungle animals and learns life lessons.

31. The Lakers have a strong philanthropic presence in the community, supporting various charitable initiatives and organizations.

32. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

33. The onset of baby fever can be triggered by various factors, such as seeing a newborn, spending time with young children, or witnessing others in their parenting journey.

34. The patient's prognosis for leukemia depended on various factors, such as their age, overall health, and response to treatment.

35. The platform offers various filters and editing tools to enhance the appearance of photos before posting.

36. Trump implemented various policies during his tenure, including tax cuts, deregulation efforts, and immigration reforms.

37. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

38. Women have made significant strides in breaking through glass ceilings in various industries and professions.

Random Sentences

1. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

2. Sila ay nagtutulungan upang magtayo ng mga organisasyon at kapatiran upang mapagtibay ang kalagayan ng bayan.

3. Matagal na kitang pinapanood at ngayon lang ako maglalabas ng katotohanan - may gusto ako sa iyo.

4. "Mahal kita," ani ng binata sa dalagang kanyang nililigawan.

5. Sumasakay si Pedro ng jeepney

6. Mahalagang mabigyan ng sapat na konsiderasyon ang mga isyu ng sektor ng anak-pawis sa pagpapasya ng mga polisiya ng pamahalaan.

7. Las hojas de mi planta de menta huelen muy bien.

8. Hi Gelai!! kamusta naman ang paborito kong pamangkin?

9. The scientific study of the brain has led to breakthroughs in the treatment of neurological disorders.

10. Nang natapos ang araw ng pagsusulit, gumawa ng paraan ang binata para makabawi sa dalaga.

11. The company's board of directors approved the acquisition of new assets.

12.

13. Los bebés pueden necesitar cuidados especiales después del nacimiento, como atención médica intensiva o apoyo para mantener la temperatura corporal.

14. Football players must have good ball control, as well as strong kicking and passing skills.

15. Born in Tupelo, Mississippi in 1935, Presley grew up listening to gospel music, country, and blues

16. Maraming bayani ang nakalikha ng mga bagong teknolohiya at kaisipan na naging pundasyon ng progreso ng bansa.

17. Ang Datu ay nalungkot at nawalan ng lakas na harapin ang katotohanan.

18. Abs yan!! Tingnan mo nga oh! May mga guhit guhit!

19. Nag-aaral tayo ng Tagalog ngayon.

20. She was born on June 26, 1993, in Boca Raton, Florida, USA.

21. Hindi pa ako naliligo.

22. Sa panahon ng tagtuyot, mas tumitindi ang init ng araw.

23. AI algorithms can be used in a wide range of applications, from self-driving cars to virtual assistants.

24. Natural language processing is a field of AI that focuses on enabling machines to understand and interpret human language.

25. Det er vigtigt at have en positiv indstilling og tro på sig selv, når man bliver kvinde.

26. Musk has been named one of the most influential people in the world by TIME magazine.

27. Ang mga tao ay nasiyahan sa nangyari.

28. Nagalit ang diwata sa ginawa ng madamot na matanda.

29. I am absolutely excited about the future possibilities.

30. Lalong nag-iyakan ang dalawang bata.

31. Det kan omfatte spil som kasinospil, lotteri, sportsbetting og online spil.

32. Inalok ni Maria ng turon si Clara.

33. Sa mga bundok, ang mga mountaineer ay nagtatanim ng puno upang mabawasan ang pagkaagnas ng lupa.

34. Tahimik na nanangis si Aling Rosa at laking pagsisisi dahil tumalab ang kanyang sinabi sa anak.

35. Nagtatanim kami ng mga halamang gamot para sa aming natural na gamutan.

36. Wala kang sapat na pera para sa bakasyon? Kung gayon, ipagpaliban mo muna ito.

37. Les enseignants jouent un rôle important dans la réussite des étudiants.

38. Ow, sorry nagising ata kita. aniya.

39. Bagaimana caranya agar bisa memenangkan perlombaan ini? (What is the way to win this competition?)

40. Supergirl, like Superman, has the ability to fly and possesses superhuman strength.

41. Talaga? aniya. Tumango ako. Yehey! The best ka talaga!

42. Dali na, ako naman magbabayad eh.

43. Mayroong mga bayani na hindi kilala ngunit nagawa nilang magpakumbaba at maglingkod sa bayan.

44. Nakakatulong ang paghinga ng malalim at pagsisimula ng halinghing para sa relaxation.

45. Einstein developed the theory of special relativity while working as a patent clerk in Bern, Switzerland.

46. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

47. I prefer to arrive early to job interviews because the early bird gets the worm.

48. Kumain ako ng sinigang sa restawran.

49. Ang mga bayani ay nagbibigay inspirasyon sa mga kabataan upang maging mabuting mamamayan.

50. Children's safety scissors have rounded tips to prevent accidental injuries.

Recent Searches

varioustrabahosapatubodfridaymalapadnakikilalangpambahaypinapasayamahawaant-ibangnangapatdancommercialwakasporbulongbayangmasukolpulitikoayabesesdiseasespeeppagodingatanbusumuwimalimitbumugapedemonitorreadregularmentestylesilocosnagpalalimpagsasalitatungawlabing-siyamiyanibabawbulaklakvelfungerendepinalambotmanghuliproducts:gisingmustassociationorugaalexandermentaldolyarmatchingmaaringbulaeveningprogresslasinghapasinulangalakhudyatwealthlikurangamitinbarriersnag-iyakant-shirtbumaligtadyorkchristmasnatintengapromotetinikagilitynakatapatkarnabalkitdebatesedit:tinangkamahabagulattuklaskarwahengkasiyahanmanamis-namisnagpaiyakmagtanghaliannakakasamamagpapabunotmagpalibrefallnanghihinamadgeologi,nanghihinamakikiraannagpagupitnaghuhumindigmuliwinasiwastaun-taonmag-aaralnagpuyosdekorasyonpanghihiyangnagdabogsinusuklalyantumakastemparaturamahinangbisitanasiyahanikukumparabusinessespaosalas-dosprincipalesedukasyonfysik,nai-dialmagsunogtumalonumiyakipinatawagsangkalanpasasalamatdecreasedkamalianfulfillmentkainitantuktoktumaposmaghihintaykakilalamahabangdiplomamassachusettsmenssampungmaaksidentenagplaymatutongbagamatmabigyannabigaysumalakayawitanmatagumpayaustraliasahodbihasakasigustongsiguroiniangathelenatenidobiglaannanigasibilikaniyamagdaanmerchandisebantulotnababalotlittlesongshunitatlongbabeshinabolmaonglipat1960sestategulangrolandrememberedmisteryoinintayhomesoundginawamariasusimagigitingtinitindananaynagisinglaruanmasipaggradalaaladogssaykingdomhomes