Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "society"

1. Advances in medicine have also had a significant impact on society

2. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

3. Another area of technological advancement that has had a major impact on society is transportation

4. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

5. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

6. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

7. Despite the many advancements in television technology, there are also concerns about the effects of television on society

8. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

9. However, there are also concerns about the impact of technology on society

10. However, there are also concerns about the impact of the telephone on society

11. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

12. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

13. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

15. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

16. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

17. Overall, television has had a significant impact on society

18. Television has a rich history, and its impact on society is far-reaching and complex

19. The awards ceremony honored individuals for their charitable contributions to society.

20. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

21. The widespread use of the telephone has had a profound impact on society

22. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

23. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

24. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

25. Women have diverse perspectives and voices that can enrich society and inform public policy.

Random Sentences

1. Mahalaga ang papel ng mga organisasyon ng anak-pawis sa pagtitiyak ng kanilang mga karapatan.

2. Nandito ang mga kaklase ni Raymond.

3. Ang aming angkan ay may malaking bahagi ng kasaysayan ng aming bayan.

4. Nabigla siya nang biglang napadungaw sa kanya ang isang ibon.

5. Sa bawat pagkakataon na binibigyan tayo ng pagkakataon, dapat nating gamitin ito nang wasto, samakatuwid.

6. She admires the beauty of nature and spends time exploring the outdoors.

7. Coping strategies such as deep breathing, meditation, or exercise can help manage feelings of frustration.

8. Napaluha si Aling Pising nang makita niya ang bunga nito.

9. Have you tried the new coffee shop?

10. Sa baguio nila napiling mag honeymoon.

11. Mas mainit sa Pilipinas kaysa dito.

12. Despues de cosechar, deja que el maíz se seque al sol durante unos días antes de retirar las hojas y las espigas

13. ¿Qué edad tienes?

14. We finished the project on time by cutting corners, but it wasn't our best work.

15. Una conciencia pesada puede ser un signo de que necesitamos cambiar nuestra conducta.

16. ¿Te gusta la comida picante o prefieres algo más suave?

17. A couple of pieces of chocolate are enough to satisfy my sweet tooth.

18. Over-emphasis can be counterproductive and may undermine the intended message.

19. Nationalism can be a source of inspiration for artists, writers, and musicians.

20. He has learned a new language.

21. Microscopes are also used in materials science and engineering to study the microstructure of materials.

22. Inirekomenda ng guro na magbasa kami ng maraming aklat upang mapaunlad ang aming kasanayan sa pagbabasa.

23. Yari sa kahoy ang sahig ng bahay ko.

24. Mahalagang mabigyan ng sapat na konsiderasyon ang mga isyu ng sektor ng anak-pawis sa pagpapasya ng mga polisiya ng pamahalaan.

25. Ganun ba talaga kalaki yung impact ng pananakot ko sa kanya?

26. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

27. Sa Chinese New Year, ang mga pamilya ay nagtitipon upang magsalu-salo at magbigayan ng mga regalo.

28. Ano ang ginawa ni Tess noong Abril?

29. La science environnementale étudie les effets de l'activité humaine sur l'environnement.

30. Pinili niyang magtungo palayo sa gulo upang makahanap ng katahimikan.

31. Hindi maganda ang amoy ng damit kung hindi ito maayos na naglalaba.

32. Nakita kita sa isang magasin.

33. Sa pagdating ng buhawi, ang mga tao ay kailangang mag-ingat at maghanda ng mga emergency kit at planong evacuation.

34. Sana, binigyan mo siya ng bulaklak.

35. Para darle sabor a un guiso, puedes añadir una ramita de hierbas de tu elección.

36. Hairdressing scissors, also known as shears, have different blade designs for different cutting techniques.

37. Ang pagbasa ng magandang libro ay isang nakagagamot na paraan upang maibsan ang stress.

38. Has he spoken with the client yet?

39. El realismo y el impresionismo son estilos populares en la pintura.

40. Está claro que necesitamos más tiempo para completar el proyecto.

41. Pakipuntahan mo si Maria sa kusina.

42. Fathers can also play an important role in teaching life skills and values to their children.

43. Martabak adalah makanan ringan yang terbuat dari adonan tepung dan isian kacang, daging, atau keju.

44. Sometimes I wish I could unlearn certain things and go back to a time when I was blissfully ignorant of the world's problems - ignorance truly is bliss in some cases.

45. Dette skyldes, at den offentlige regulering sikrer, at der er en vis grad af social retfærdighed i økonomien, mens den frie markedsøkonomi sikrer, at der er incitamenter til at skabe vækst og innovation

46. Maaaring magkaroon ng interest at late fees kapag hindi nabayaran ang utang sa tamang panahon.

47. The actor received a hefty fee for their role in the blockbuster movie.

48. The conference brings together a variety of professionals from different industries.

49. La conciencia nos recuerda nuestros valores y nos ayuda a mantenernos fieles a ellos.

50. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Recent Searches

bihasasocietyheartbreaknegosyoahasdesarrollarantoksapilitangpondosinasabiapoygoalmaibalikkahilingantelefonkumatokinvitationsuotestilosfionawarisolarpakilutobilaoiconicumaagosfilmilogbecomerabediagnosesmeaningtradesupremeejecutanprocesohamakmegetbatidinalawcryptocurrency:nagbungafiguresmalapittandaimaginationprosperpocascientistdumagundonginspiredfatalwaysakinadddragonbaku-bakongikinamataynakakapagpatibaymagkahawakhiningitvspagtiisannakakatulonggratificante,strategiesnakapagsabinapapahintonapapansinmagtatampomahahawavitaminmukhanaiinitankubokutsilyosabogbilanggohetotransmitidastanganmanuscriptsalitangsilbingstarcriticsmarumibagyoinalisupworknakikini-kinitanagmakaawakonsentrasyonpinagpatuloykinikitalumalangoyikinasasabikpare-parehopunongkahoylinggongtotoongmagbibigaypawiininaaminpagkaraalalakipaglakinandayakinantakinakabahantreatsnagsunuransaritamagpalibremagkakailapagkakalutonakumbinsimaghahatidsagasaaninvesting:naibibigaynegro-slavesmakikikainpagkalitonakuhangnakatitigkanginavideosnapuyato-onlinepinigilanmagturomagbalikrodonatinatanongpinangalanankadalasmagsisimulatumamispagtatakajejupabulongmusicallilipadobservation,makatifreedomsumulansunud-sunodmanakbomakisuyocaracterizatumindigpapayalibertynagtaposnagwaliswriting,gawaingmakalawaopportunitysagotmauntogpakainintataasanungrenaiahinanapcarmenproducts:maisipthroatbutoyamanexperts,riyanedsapitumpongnatalongkarangalanautomationkapainwashingtonmapahamaktsakalandairconsumuotdumaanlaybrarinagturosumayaahitlosslagiiniwanreachbusloattractivesink