Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "society"

1. Advances in medicine have also had a significant impact on society

2. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

3. Another area of technological advancement that has had a major impact on society is transportation

4. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

5. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

6. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

7. Despite the many advancements in television technology, there are also concerns about the effects of television on society

8. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

9. However, there are also concerns about the impact of technology on society

10. However, there are also concerns about the impact of the telephone on society

11. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

12. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

13. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

15. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

16. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

17. Overall, television has had a significant impact on society

18. Television has a rich history, and its impact on society is far-reaching and complex

19. The awards ceremony honored individuals for their charitable contributions to society.

20. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

21. The widespread use of the telephone has had a profound impact on society

22. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

23. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

24. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

25. Women have diverse perspectives and voices that can enrich society and inform public policy.

Random Sentences

1. Marahil anila ay ito si Ranay.

2. Other parts of the world like Burma and Cuba also cultivated tobacco

3. Ano ang naging sakit ni Tita Beth?

4. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

5. Wala kang pakelam! O sige its my turn na!

6. Nakatingin siya sa labas ng bintana, waring may hinihintay.

7. Ikaw pala, Katie! Magandang hapon naman.

8. Nagdiretso ako sa kusina at binuksan ang ref.

9. Mahal na mahal ng ama't ina si Ranay.

10. Ang ganda ng bagong laptop ni Maria.

11.

12. Humingi siya ng makakain.

13. A couple of pieces of chocolate are enough to satisfy my sweet tooth.

14. La historia del arte abarca miles de años y se extiende por todo el mundo.

15. Ang kanyang galit ay nagbabaga sa ilalim ng malamig niyang mga ngiti.

16. Anong oras gumigising si Katie?

17. Healthcare providers and hospitals are continually working to improve the hospitalization experience for patients, including enhancing communication, reducing wait times, and increasing patient comfort and satisfaction.

18. Si Juan ay nadukot ang cellphone dahil sa isang magnanakaw sa kalsada.

19. Ang Linggo ng Pagkabuhay ay pagdiriwang.

20. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

21. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

22. Les personnes âgées peuvent bénéficier d'un régime alimentaire équilibré pour maintenir leur santé.

23. Paano ho ako pupunta sa Palma Hall?

24. I've been following the diet plan for a week, and so far so good.

25. Los powerbanks suelen tener puertos USB que permiten conectar diferentes tipos de dispositivos.

26. Scientific data has helped to shape policies related to public health and safety.

27. "Dog is man's best friend."

28. Pinangaralan nila si Tony kung gaano kahalaga ang isang ama

29. Kumain ako ng sinigang sa restawran.

30. A couple of dogs were barking in the distance.

31. Mas romantic ang atmosphere sa dapit-hapon.

32. Motion kan udføres indendørs eller udendørs, afhængigt af ens præferencer og tilgængeligheden af ​​faciliteter.

33. Cheating is the act of being unfaithful to a partner by engaging in romantic or sexual activities with someone else.

34. Sa halip na maghanap, sinalat na lang niya ang ibabaw ng mesa para sa relo.

35. Sa halip na umalis ay lalong lumapit ang bata.

36. Emphasis is an important tool in public speaking and effective communication.

37. Bagaimana cara mengirimkan email? (How to send an email?)

38. Si Ma'am Luisa ay magbabakasyon sa kanilang probinsya.

39. The police were trying to determine the culprit behind the burglary.

40. La ganadería y el cultivo de pastos van de la mano en muchas explotaciones agrícolas.

41. Si Mabini ay isa sa mga pinakamatatalinong lider sa panahon ng himagsikan sa Pilipinas.

42. Ano namang naiisip mo? tanong ko sa mapag-asang tono.

43. El estudio de la música ayuda a las personas a desarrollar habilidades importantes, como la creatividad, la concentración y la capacidad de trabajar en equipo

44. Setiap tantangan membawa pelajaran berharga yang dapat digunakan untuk menghadapi tantangan berikutnya.

45. Tiyak na may isda kang mahuhuli! Sige, layas! Layas! pinagtulakan ni Kablan ang kaawa-awang matanda na napasubsob sa tarangkahan ng malaking bahay.

46. Omelettes are a popular choice for those following a low-carb or high-protein diet.

47. Ah eh... okay. yun na lang nasabi ko.

48. Sí, claro, puedo esperar unos minutos más.

49. Las hierbas de té, como la manzanilla y la melisa, son excelentes para calmar los nervios.

50. Les maladies mentales sont souvent mal comprises et stigmatisées dans de nombreuses cultures.

Recent Searches

sakopsocietypayongtinitindabonifacioamerikaboksingtools,aaliszoombatipitakadollycryptocurrencytododuonginangconventionaldragonspacommunicationsadvancedproducirinalokpersonalbalepocaperlaplatformsattorneyre-reviewbalikmahahabahatingdevelopngunitindustriyaadvancementremembertiyancynthiapagkakatuwaanlayuninbuung-buolordmemorialmang-aawitmagkaibanamilipitpag-isipanmaskidiwatangcruzpaninginpahirapangumigisingkatutubopinigilanmahahaliklorenaputititamisteryomaglaropasyentepandalawahantuwingmalamanggalitdahilmakapangyarihangkomunikasyonnaguguluhanrevolutionerettsaalutohjemstedhouseholdbusabusiniyongandamingdiretsahanghiwabisikletaasoentrenapakahabaarmaelkutisalamidpoottessginaganoonhahahapamumuhaytinikmanpagmasdansinehanmgahinabolparoroonaalaknapuyatnahulikayodarkexplainklimamadulasnilalangpagluluksadistanciataga-hiroshimainstitucionesgalaankumalmainterpretingeranmagtatapospogimaghilamosmaranasanpapuntangnakaupomulanatayotapatwakasmagisingpublished,tinaposattentioncanadananaogpropesormatabanghalatangyelopicsnilinisyourself,busyangmaninipistokyopinag-usapannakatuonpakilagaykarapatangnangagsipagkantahanstagemaskinerbopolsubodespigasikawalongnoongleytedevelopednaritokristouseelectronicmagpapaikotsundhedspleje,basahinbinasatrycyclekarwahengbiocombustiblesvasqueslinekumbinsihinkalabawplantasamericaheartbeatandoyalinglupainbilingkasibadingnataposmakakibopedeabalaisugagawaingnumerosasmaaritwitchmaalwangejecutanpaungolsagotsumalacongratsemailkumantamagpalibre