Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "society"

1. Advances in medicine have also had a significant impact on society

2. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

3. Another area of technological advancement that has had a major impact on society is transportation

4. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

5. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

6. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

7. Despite the many advancements in television technology, there are also concerns about the effects of television on society

8. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

9. However, there are also concerns about the impact of technology on society

10. However, there are also concerns about the impact of the telephone on society

11. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

12. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

13. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

15. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

16. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

17. Overall, television has had a significant impact on society

18. Television has a rich history, and its impact on society is far-reaching and complex

19. The awards ceremony honored individuals for their charitable contributions to society.

20. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

21. The widespread use of the telephone has had a profound impact on society

22. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

23. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

24. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

25. Women have diverse perspectives and voices that can enrich society and inform public policy.

Random Sentences

1. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

2. When he nothing shines upon

3. The acquired assets will help us expand our market share.

4. Pinaghihiwa ko ang mga kamatis.

5. Sa sobrang pagod, nagawa niyang paglimot sa mga pangyayari ng nakaraang araw.

6. Aling hayop ang nasa tabi ng puno?

7. May maruming kotse si Lolo Ben.

8. Piece of cake

9. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

10. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

11. Dali-daling umalis ang binata patungo sa palasyo.

12. Paano mo pinaghandaan ang eksamen mo?

13. Electric cars can be equipped with advanced safety features such as collision avoidance and pedestrian detection systems.

14. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang ligawan?

15. Laughter is the best medicine.

16. Ang debate ay ukol sa mga isyu ng korapsyon sa gobyerno.

17. Miguel Ángel dejó muchas obras inacabadas, incluyendo su proyecto para la tumba de Julio II.

18.

19. Catch some z's

20. Hinintay lamang niya ang aking pagdating.

21. I've been driving on this road for an hour, and so far so good.

22. Ako ay bumili ng lapis sa tindahan

23. Bukas na lang ako pupunta sa bangko.

24. Dapat niyo akong pagsilbihan dahil dito.

25. Les soins de santé mentale de qualité sont essentiels pour aider les personnes atteintes de maladies mentales à vivre une vie saine et productive.

26. May I know your name for our records?

27. Nanalo siya ng Palanca Award para sa panitikan

28. Sa facebook ay madami akong kaibigan.

29. Mahilig kang magbasa? Kung gayon, baka magustuhan mo ang bagong librong ito.

30. Tapos nag lakad na siya papunta sa may kotse.

31. Las escuelas son responsables de la educación y el bienestar de los estudiantes.

32. Agad na kumalat ang balita na may dala si Ana na pagkain, kaya sumugod sila sa bahay ni Aling Rosa.

33. Awang-awa ang maraming katutubo sa pagpapasan sa krus si Padre Novelles.

34. Hindi tayo sigurado/nakatitiyak.

35. Maraming Pinoy ang magaling sa pagluluto ng mga lutong bahay.

36. Receiving recognition for hard work can create a sense of euphoria and pride.

37. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

38.

39. Money can be earned through various means, such as working, investing, and entrepreneurship.

40. Les soins de santé de qualité sont un droit fondamental de chaque individu.

41. Isang linggo nang makati ho ang balat ko.

42. They do not litter in public places.

43. Børns sundhed og trivsel bør være en prioritet i samfundet.

44. Hinde kasi ako mapakali kaya pumunta ako dito.

45. In the years following his death, Presley's legacy has continued to grow

46. Ang bawat paaralan ay nag-aapuhap ng mga donasyon para sa bagong aklat at kagamitan ng kanilang mga mag-aaral.

47. Si Hidilyn Diaz ay isang inspirasyon para sa maraming Pilipino, lalo na sa mga kabataan.

48. Dapat tayong magpasya ayon sa tamang paninindigan at prinsipyo, samakatuwid.

49. El trabajo de parto puede durar varias horas o incluso días, dependiendo del caso.

50. May mga taong may agam-agam sa mga pangarap nila sa buhay kung ito ba ay magkakatotoo o hindi.

Recent Searches

societykumaininaasahangsapatamericanmaibalikmagalangilalimkinagagalakaddressmarangalkanserbikolpahingasang-ayonpitakakaliwafacebooklibredragonkatawangmagnakawaddouemauliniganrumaragasanghumayomediadinprinsipenagpasanalisestudyantetinitirhanpagbebentametronami-misscupidpakialammagdamagtungawnauntogkinalalagyanmealmagandangmalayanginyongharap-harapangsiyudadmagpakasalnalulungkotmagbakasyonnakatuloguugod-ugodpakisabitheirtaong-bayanmabangomonetizingsiyang-siyaisipanmagpapigilmahinogseguridadsamakatwidkasinaglipanaapelyidointindihinmarketing:lumbayhawlakonsyertoiyokabuhayaneleksyonmukhaginawamayanakaluhodimpordowngaginangsoundorasseesellpersonssensiblephysicalkangmahalaganakabanggakumaliwainiisipdisappointedsimplengeffectsnagagalitmaisipinilalabasnagkakatipun-tiponkoryentecreditbritishnakapamintanapayatpapuntanglimitmarurumiyamansinabipauwirecibirbutilbinilhannooyourmayroonnatutuwalangstagepagbabantakahonfeedbackprogrammingligaligpanigpolomagbabakasyonpunongkahoynakasandigpagkahapomalulungkottinderanagwagiagricultoresmasayahinnakaraannatatawagospelyumaocorporationnanagsalarinnatuyomakalingfulfillmentnangingisaysocialegiraygloriaeksportenpanimbangcrosspalitanricakombinationsumingitdomingoejecutanaumentarallottedlivesnaiinitankanilamatangdisappointoliviafremstilletaposdalawsaloninvolvereturnedstuffednalasingmalapitasoloobpagdukwangitakkaysanagsamamaaarinicolasganunnaglahongngisirequierenpandemyawalangninaistaoswashingtongawaingnakabulagtangcover,podcasts,