Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "society"

1. Advances in medicine have also had a significant impact on society

2. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

3. Another area of technological advancement that has had a major impact on society is transportation

4. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

5. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

6. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

7. Despite the many advancements in television technology, there are also concerns about the effects of television on society

8. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

9. However, there are also concerns about the impact of technology on society

10. However, there are also concerns about the impact of the telephone on society

11. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

12. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

13. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

15. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

16. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

17. Overall, television has had a significant impact on society

18. Television has a rich history, and its impact on society is far-reaching and complex

19. The awards ceremony honored individuals for their charitable contributions to society.

20. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

21. The widespread use of the telephone has had a profound impact on society

22. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

23. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

24. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

25. Women have diverse perspectives and voices that can enrich society and inform public policy.

Random Sentences

1. She carefully layered the cake with alternating flavors of chocolate and vanilla.

2. Sueño con viajar por todo el mundo. (I dream of traveling around the world.)

3. Tweets are limited to 280 characters, promoting concise and direct communication.

4. The event was sold out, and therefore we couldn't get tickets.

5. Hinampas niya ng hinampas ng kidkiran ang binatilyong apo.

6. Twinkle, twinkle, little star.

7. Ang mabuting kaibigan, ay higit pa sa kayamanan.

8. Maarte siya sa mga klaseng pagkain kaya hindi siya nakikisabay sa mga inuman sessions.

9. La música puede ser utilizada para fines políticos o sociales.

10. Hindi ko mapigilan ang aking mga titig sa aking nililigawan dahil sobrang ganda niya.

11. "Ang buhay ay parang gulong, minsan nasa taas, minsan nasa baba," ani ng matandang nagkukuwento.

12. Hindi maaring magkaruon ng kapayapaan kung ang marahas na kaguluhan ay patuloy na magaganap.

13. Ngayon ko pa lamang nakita ang halaman na ganito.

14. Sa aksidente sa kalsada, maraming tao ang nasugatan at ilang pasahero ang namatay.

15. Smoking is influenced by various factors, such as peer pressure, stress, and social norms.

16. Hindi ko mapigilan ang aking inis kapag nakikita ko ang kawalang-katarungan.

17. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

18. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

19. Inakalang ligtas ang lugar, pero may paparating palang bagyo.

20. The king's coronation is a ceremonial event that officially marks his ascension to the throne.

21. Limitations can be challenging, but they can also inspire creativity and innovation.

22. Amazon is an American multinational technology company.

23. Sa Calamba, Laguna ipinanganak ang pambansang bayani na si Jose Rizal.

24. Ang tugtugin ay may mababa ngunit malalim na tono.

25. Para sa akin ang pantalong ito.

26. They have studied English for five years.

27. Naglalaba siya ng mga kumot at kurtina upang mapanatili ang kalinisan ng aming tahanan.

28. Tumayo siya tapos humarap sa akin.

29. Schönen Tag noch! - Have a nice day!

30. The investment horizon, or the length of time an investor plans to hold an investment, can impact investment decisions.

31. Maaari po bang makahingi ng sobra sa hapunan ninyo?

32. Les ingénieurs appliquent la science pour créer des produits et des systèmes.

33. La novela de Gabriel García Márquez es un ejemplo sublime del realismo mágico.

34. Einstein's work led to the development of technologies such as nuclear power and GPS.

35. Palibhasa ay madalas na nagsusulong ng mga bagong ideya at mga panukala dahil sa kanyang malawak na pananaw.

36. Kung ako sa kanya, niligawan na kita

37. Maraming Pinoy ang nagta-trabaho sa ibang bansa bilang OFW.

38. Ano ang ilalagay ko sa kusina?

39. Nagpunta ako sa theme park kasama ang mga kaibigan ko kaya masayang-masaya ako ngayon.

40. It is a versatile dish that can be customized with various fillings and toppings.

41. Børn med særlige behov har brug for ekstra støtte og ressourcer for at trives.

42. The acquired assets were carefully selected to meet the company's strategic goals.

43. Dahil ang alam lang ay kumain, hindi alam ni Ranay kung paano ma-buhay na siya ang kikilos at magta-trabaho.

44. Upang huwag nang lumaki ang gulo ay tumahimik na lang si Busyang, nagpatuloy naman sa pakikipagtagpo sa mayamang Don Segundo ang ambisyosang anak.

45. Sa gitna ng dilim, nagbabaga ang mga uling sa apoy, nagbibigay-liwanag sa paligid.

46. Gusto mo ba ng isa pang tasa ng kape?

47. They do not skip their breakfast.

48. Mataaas na ang araw nang lumabas si Aling Marta sa bakuran ng kanilang maliit na barung-barong.

49. Habang naglalakad sa park, pinagmamasdan niya ang mga puno na sumasayaw sa hangin.

50. Kagyat na sumagot ang amang nangingitngit, ngunit siya man ay pinagwikaan din ni Aya.

Recent Searches

sarongmukhasocietyestadospaglayasnatitirangitinaasmaghaponginfusionesfederalsayawanmauboskatulongmagsimulabayangallepulongalagapokerkuwebasantosculpritgreatlyeneroprosesodiaperpersonbalinganlunesnatulaklutuinsumuotchoosesumigawmatulisayawcompositoressikoplagasangalpeppylandocitizenaabothiningigrammardangerousmansanasalaalatresmukapakilutonogensindeahitsystematiskexambusiness,diamondgeneipaliwanagguhitsantomadurasmorenacompanyteachcoinbaseeasier1973godadverselyasinnilangtanimso-calledsagingharmfulspeeddumatingpublishinglaylaystudentpasangtripmabutingcommunicateresponsibledollarlimitsamacreationfascinatingratedecisionsrestexpectationsnapakasipagscaleinteligentesthroughconsideruponcasesleftgotinvolvemagpaliwanagnagsisigawsasayawinkaklasemalulungkothinogmamahalinkampeonnapilinapasumisidkatolikoconsuelosino-sinopamimilhingbitiwanasimkalanjamesinternalcertainconvertingalbularyonegosyantenapipilitanhampaslupapamumunomahinangnanunuksodistanciamakenaiiritangnakapasoksampungsalbahetirangfollowedmassachusettsnababalotmamanhikanligaligmagdilimcocktailvaledictorianasiawednesdaytsssdatapwathappenedbinanggaknightfreelancerkumaripasusanaroonboxrangemagsalitakumbinsihinnagmistulangnag-iimbitanagpabotopisinahastaideyainangknowinuulcerbulakalakbintanabutikinilapitangumisingmedyointerestsnakapuntanumerosasmakulitkinauupuangnoolabanhumanosislacondingginalakitinagomasukoltoretekaniyakakilalahiwahumampasgagawa