Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "society"

1. Advances in medicine have also had a significant impact on society

2. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

3. Another area of technological advancement that has had a major impact on society is transportation

4. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

5. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

6. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

7. Despite the many advancements in television technology, there are also concerns about the effects of television on society

8. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

9. However, there are also concerns about the impact of technology on society

10. However, there are also concerns about the impact of the telephone on society

11. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

12. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

13. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

15. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

16. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

17. Overall, television has had a significant impact on society

18. Television has a rich history, and its impact on society is far-reaching and complex

19. The awards ceremony honored individuals for their charitable contributions to society.

20. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

21. The widespread use of the telephone has had a profound impact on society

22. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

23. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

24. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

25. Women have diverse perspectives and voices that can enrich society and inform public policy.

Random Sentences

1. "You can't teach an old dog new tricks."

2. Sa paggamit ng mga kagamitan, huwag magpabaya sa tamang pag-aalaga at pagpapanatili nito.

3. Tuwing biyernes, ginugol niya ang buong araw sa paglilinis at paglalaba ng bahay.

4. La paciencia es la clave para conseguir lo que deseamos.

5. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

6. Ang aming mga pangarap at layunin ay pinagsasama namin bilang magkabilang kabiyak.

7. Nakakamiss kumain ng pulotgata tuwing tag-araw kasama ng pamilya.

8. Ang kamalayan sa kalagayan ng kalikasan ay nagtutulak sa atin na alagaan ito para sa susunod na henerasyon.

9. The moon shines brightly at night.

10. Sa larong volleyball, ipinasa ni Liza ang bola sa kanyang kakampi.

11. Bakit umiiling ka na naman? May problema ka ba?

12. Bwisit ka sa buhay ko.

13. At være transkønnet kan påvirke en persons mentale sundhed og kan føre til depression, angst og andre psykiske udfordringer.

14.

15. Wala akong pakelam! Dapat sayo pinapalo!

16. En algunas regiones, el invierno puede ser muy frío y peligroso para la salud si no se toman las precauciones adecuadas.

17. Lumiwanag ang silangan sa pagsikat ng araw.

18. The cost of a wedding can vary greatly depending on the location and type of wedding.

19. Politics in America refers to the political system and processes that take place in the United States of America

20. Nang magbago ang mga pangyayari at matanggap ko ang mga kaganapang hindi ko inaasahan, ang aking pagkabahala ay napawi.

21. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

22. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

23. Inalalayan ko siya hanggang makarating sa abangan ng taxi.

24. Nag toothbrush na ako kanina.

25. Sa lahat ng bagay, mahalaga ang tamang panahon.

26. Frustration can be caused by external factors such as obstacles or difficulties, or by internal factors such as lack of skills or motivation.

27. Musk has expressed interest in developing a brain-machine interface to help treat neurological conditions.

28. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

29. Hinanap nito si Bereti noon din.

30. Inisip ko na lang na hindi sila worth it para hindi ako mag-inis.

31. Es importante cosechar las zanahorias antes de que se pongan demasiado grandes.

32. Ang tubig-ulan ay isa sa mga pinakamahalagang pinagmumulan ng tubig sa mga ilog at lawa.

33. Los médicos y enfermeras estarán presentes durante el parto para ayudar a la madre y al bebé a pasar por el proceso.

34. Oh.. hindi ko alam ang sasabihin ko.

35. Maaf, saya terlambat. - Sorry, I'm late.

36. Mababaw ang swimming pool sa hotel.

37. My daughter is in her school play tonight - I told her to break a leg.

38. Pulau Komodo di Nusa Tenggara Timur adalah rumah bagi kadal raksasa komodo yang langka dan merupakan situs warisan dunia UNESCO.

39. Ha?! Ano ba namang tanong yan! Wala noh!

40. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

41. Nais niyang makalimot, kaya’t naglakbay siya palayo mula sa kanyang nakaraan.

42. Tomar decisiones que están en línea con nuestra conciencia puede ayudarnos a construir una vida significativa y satisfactoria.

43. Bumalik siya sa Pilipinas kasama ang suporta ng mga Amerikano noong 1898.

44. Hindi ka sanay sa matinding init? Kung gayon, manatili ka sa lilim o sa malamig na lugar.

45. Supergirl, like Superman, has the ability to fly and possesses superhuman strength.

46. Unfortunately, Lee's life was cut short when he died in 1973 at the age of 32

47. La música es un lenguaje universal que trasciende las barreras del idioma y la cultura

48. Insider trading and market manipulation are illegal practices that can harm the integrity of the stock market.

49. Pinagpalaluan ang Kanyang karunungan.

50. Ang paggamit ng teknolohiya ay nagbibigay daan sa iba't ibang uri ng hudyat, tulad ng emoji sa text messaging o facial expressions sa video calls.

Recent Searches

pinagkaloobansocietyguitarranangyayarikanginapagsalakaymagagawaedukasyonmakahiramlivesgumisingcasharawnaghinalaindeniikutanflyvemaskinerboteatinghalikabunutansang-ayonatensyonuusapanlayawbintanauulaminsigephilosophicaltonyopalasyoryannagpapaigibkirotcupidma-buhaymenospaggawalaryngitisnamumukod-tangipagkamanghaparticipatingpulasilaysupilinkayoubodumokayclientesnagpabotmataraysagingbagallamangcelularesgjortmanilatextomulti-billioncomputere,lumikhamasakitherramientamahuhulialintuntunindurianpotentialnatitiyakkakaroonpaladngunitmabangorektangguloiyoncalidadnatutuwahislumbaynabighanipag-aalalasakanaghubadnapagodginangkulisapmaglarobigongproductividadmariloupinagalitansugatanleadersmabibingifakeonlybagkusmaliksiawardinatakeiniresetabulaklakhumanoeksport,pagpapautangnakainomnagsmiledumaanpasanmagkasintahandispositivonakarinighuwebesmagpagupitmagbabagsikipabibilanggocurrentbibigyanlaranganmatandangmarketingmakakibomainstreamkuripotorugapagkakapagsalitagamitintumalimyunginnovationmayosuccessfulsahigtumahantanghalipayapanglinggomukhabilisnagpatuloyproducirginoongnilutopdaauthordoscomplexhalamannatakotmulatugonbalik-tanawenvironmentpumulotbreakpandidiriitutolmagisingmuchaspusaproducepinoytobaccomalakaspinasalamatanopportunitykampotravelersumisidpresence,itinatapattinikmanpinakamahabapinaghatidanapelyidobecomemoneyallowssupportpaghalakhakkasakitutusanimproveulitroleiba-ibanggalaanalegoodmababangongblusabumigaypataysusulitparusahannaritoexcitedpare-parehoplayslegislativeapoy