Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "society"

1. Advances in medicine have also had a significant impact on society

2. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

3. Another area of technological advancement that has had a major impact on society is transportation

4. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

5. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

6. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

7. Despite the many advancements in television technology, there are also concerns about the effects of television on society

8. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

9. However, there are also concerns about the impact of technology on society

10. However, there are also concerns about the impact of the telephone on society

11. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

12. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

13. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

15. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

16. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

17. Overall, television has had a significant impact on society

18. Television has a rich history, and its impact on society is far-reaching and complex

19. The awards ceremony honored individuals for their charitable contributions to society.

20. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

21. The widespread use of the telephone has had a profound impact on society

22. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

23. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

24. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

25. Women have diverse perspectives and voices that can enrich society and inform public policy.

Random Sentences

1. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

2. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

3. She enjoys cooking a variety of dishes from different cultures.

4. Ang purgatoryo ay nagpapakita ng kahalagahan ng paglilinis at pag-aayos ng kaluluwa bago pumasok sa langit.

5. Las escuelas también tienen la responsabilidad de asegurar un ambiente seguro para los estudiantes.

6. La internet ha cambiado la forma en que las personas acceden y consumen información en todo el mundo.

7. At følge sin samvittighed kan være afgørende for at træffe de rigtige beslutninger i livet.

8. Kayo din po ba ang nagpapakain sa kanya?

9. Up above the world so high,

10. Magandang maganda ang Pilipinas.

11. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

12. The widespread use of the telephone has had a profound impact on society

13. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

14. Don't underestimate someone because of their background - you can't judge a book by its cover.

15. Elektronik er en vigtig del af vores moderne livsstil.

16. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

17. Hormonbehandling og kirurgi kan have forskellige risici og bivirkninger, og det er vigtigt for transkønnede personer at konsultere med kvalificerede sundhedspersonale.

18. La santé est un état de bien-être physique, mental et social complet.

19. Les chatbots d'intelligence artificielle peuvent aider les entreprises à répondre aux demandes des clients.

20. Ang panitikan ay mahalagang bahagi ng kultura ng isang bansa.

21. Nakipag bahay-bahayan kay Athena.

22. Le marché boursier peut être un moyen de faire fructifier son argent.

23. Practice makes perfect.

24. Bilin ni Aling Pising na lagi niyang aayusin ang kaniyang buhok upang hindi maging sagabal sa kaniyang mga gawain at pag-aaral.

25. Bumalik siya sa lugar ng aksidente at tulala sa nangyari.

26. Mahalagang maging totoo sa ating mga sarili at sa mga taong nakapaligid sa atin, datapapwat ay may mga pagkakataon na tinatago natin ang ating mga tunay na damdamin.

27. Ngunit marumi sila sa kanilang kapaligiran.

28. She had a weakened immune system and was more susceptible to pneumonia.

29. El cultivo de hortalizas es fundamental para una alimentación saludable.

30. Ang mga kundiman ay patunay na ang pag-ibig ay may lakas na magdulot ng ligaya at kalungkutan.

31. Sí, claro, puedo prestarte algo de dinero si lo necesitas.

32. Electric cars have lower fuel costs than gasoline-powered cars since electricity is generally cheaper than gasoline.

33. Mas magaling siya kaysa sa kanya.

34. Nang biglang lumindol at nawala ang matabang babae, isang diwatang ubod ng ganda ang lumitaw sa harap niya.

35. Sa mula't mula pa'y itinuring na siya nitong kaaway.

36. Ininom ni Henry ang kape sa kusina.

37. Ang malalakas na hagupit ng hangin sa gitna ng bagyo ay binulabog ang mga puno at nagdulot ng pagkasira sa mga istraktura.

38. "Mahalaga ang edukasyon," ani ng aking ama noong bata pa ako.

39. Nagbakasyon kami sa tabi ng karagatan noong tag-init.

40. Nag-aalalang sambit ng matanda.

41. A palabras necias, oídos sordos. - Don't listen to foolish words.

42. Mahilig maglaro ng video games si Marvin.

43. Ate Annika naman eh, gusto ko ng toy!

44. Ang malakas na tunog ng sirena ay binulabog ang katahimikan ng lungsod.

45. A continuación se detallan los pasos para cultivar maíz en casa o en un pequeño huerto

46. Gusto ko sanang makabili ng bahay.

47. Nous allons nous marier à l'église.

48. Gusto ko lang ng kaunting pagkain.

49. La crisis económica produjo una gran inflación que afectó a los precios.

50. Mababaw ang swimming pool sa hotel.

Recent Searches

moneyiniangatwastesocietysakyanininomhanapinfavorlakaduwakmaisipiniintayisamanasanbalangwidelymatayogguidanceiyaknagdaosmaghintaydadaloanilahusomenosadversepierultimatelypakainkabosesingatantiketpaghingiipantalopdahaninterestsnakasuottemperaturapagtangisresultpaslithoweverpreviouslyinisbelievedbuspitakaprobablementemesangmaliniswalangmajorproblemaincreasestipfirstclientescorrectingnariningregularmenteandrefallabringdinggininilingplanitlogcoachingformswaithategeneratedcreatecomputermakapilinghighestmonitortabastructureevolvetwowindowerhvervslivetsasambulatnaantigsakristanmahahanaysisentasiyangbawatdiliginnasasakupannakapilanagtatanimmatangumpayawitinturonsisipainprosesogigisingsnalamannaginghardingumapangclasesreservessasagotproyektoverymemoryuugud-ugodniyonitinindighulihanrobinphilanthropypaghangamanahimikalapaapdavaoumiibignaabotvisualaposundaeagosbansangbingopasswordmurangcountlessgapkagubatanbroadnaroonnagtungomahagwaysearchnakaka-inbukasnegosyantemagpasalamatkwelyonakapikitbarcelonabagohangaringbinatilyomatitigaslumilipadnakalipasmakapalagnatigilanmahiwagangkaraminailigtasinasikasosasayawinluluwasmalasutlanagtitiispagtatanimpinag-aaralanhoneymoonpinaghandaansanggolahitmasaholbuwisnauntogspecialtinawagpamasahedistanciakarganginaabothumihingiseryosongallebayangkubyertoscultivamusiciansnamatherapyreportsolar1940kaliwasilbingresignationasobigote00amgabingtuwingsaidsemillasaniya