Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "sweet"

1. A couple of pieces of chocolate are enough to satisfy my sweet tooth.

2. Ang sabi nya inaantay nya daw girlfriend nya! Ang sweet!

3. I love you, Athena. Sweet dreams.

4. Many cultures have traditional sweet treats, such as baklava, churros, and mochi.

5. Some fruits, such as strawberries and pineapples, are naturally sweet.

6. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

7. Some people have a sweet tooth and prefer sweet flavors over others.

8. Some sweet foods have cultural and religious significance, such as honey in Jewish traditions and dates in Muslim traditions.

9. Sweet foods are often associated with desserts, such as cakes and pastries.

10. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

Random Sentences

1. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

2. Nagbabaga ang talakayan sa klase habang nagtatalo ang mga mag-aaral tungkol sa isyu.

3. Mas masaya naman ako pag napapasaya kita eh.

4. Emphasis can be used to express emotion and convey meaning.

5. Pumasok po sa restawran ang tatlong lalaki.

6. Kumaripas ng takbo ang kabayo nang bumitaw ang sakay nitong tao.

7. Mi novio me sorprendió con un regalo muy romántico en el Día de los Enamorados.

8. It ain't over till the fat lady sings

9. Ang utang ay nangangahulugan ng pagkakaroon ng obligasyon na magbayad ng isang halaga sa isang tiyak na panahon.

10. Tesla's Gigafactories, such as the Gigafactory in Nevada, are massive production facilities dedicated to manufacturing electric vehicle components and batteries.

11. El papel del agricultor en la sociedad es crucial para garantizar la seguridad alimentaria.

12. Ang buhay ay isang mumunting paraiso lamang.

13. Les hôpitaux peuvent être surchargés en période de crise sanitaire.

14. They have won the championship three times.

15. Ang magnanakaw ay mahigpit na inabangan ng mga pulis matapos ang operasyon.

16. La paciencia es clave para alcanzar el éxito.

17. Les banques jouent un rôle clé dans la gestion de l'argent.

18. La diversificación de cultivos ayuda a reducir el ries

19. Digital oscilloscopes convert the analog signal to a digital format for display and analysis.

20. Con paciencia y perseverancia todo se logra.

21. Sa sarili, nausal niyang sana'y huwag siya ang maging paksa ng paghaharutan at pagkakatuwaan ng mga agwador.

22. Ang ganda naman ng bago mong cellphone.

23. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

24. Las hojas de otoño son muy bonitas en la ciudad.

25. Unser Gewissen kann uns vor schlechten Entscheidungen bewahren und uns auf den richtigen Weg führen.

26. The team's colors are purple and gold, and they play their home games at the Staples Center.

27. Ang pagmamalabis sa pagkain ng matataba at malasa ay maaaring magdulot ng problema sa kalusugan.

28. Nanlilimos ang magandang babae ng makakain.

29. Sa pagkakaroon ng pagkakamali, hindi maiwasang maglabas ng malalim na himutok.

30. Maarte siya sa kanyang kagamitan kaya hindi siya nagpapahiram ng kanyang mga bagay.

31. Sang-ayon ako na ang edukasyon ay isang mahalagang pundasyon sa pag-unlad ng isang bansa.

32. Many financial institutions, hedge funds, and individual investors trade in the stock market.

33. Antes de irme, quiero decirte que te cuídes mucho mientras estoy fuera.

34. Hinugot niya ang kanyang kaisipan upang makaisip ng magandang solusyon sa problema.

35. Gaano kalaki ho ang gusto niyo?

36. Siembra las semillas en un lugar protegido durante los primeros días, ya que el maíz es sensible al frío

37. El internet ha hecho posible la creación de comunidades en línea alrededor de intereses comunes.

38. Representatives often hold regular meetings or town halls to connect with their constituents and gather feedback.

39. Chester A. Arthur, the twenty-first president of the United States, served from 1881 to 1885 and signed the Pendleton Civil Service Reform Act.

40. Endvidere er Danmark også kendt for sin høje grad af offentlig velfærd

41. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

42. La realidad a veces es cruel, pero debemos enfrentarla con valentía.

43. Amazon is an American multinational technology company.

44. Los héroes son ejemplos de liderazgo y generosidad.

45. Nasarapan siya kaya nag-uwi pa para sa mga kababayan.

46. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

47. Thor possesses god-like strength and wields a powerful hammer called Mjolnir.

48. Saka sila naghandang muli upang ipagtanggol ang kanilang bayan.

49. Omelettes are a popular choice for those following a low-carb or high-protein diet.

50. Some sweet foods have cultural and religious significance, such as honey in Jewish traditions and dates in Muslim traditions.

Recent Searches

leocompostelasweetultimatelymakisigpunsoipapaputolreadersoperahanmagulayawiyonnagmungkahichinesematangpagbahingwowritwalcryptocurrencypootsumasambacommunitysakinkabibipuedeheiearlypasangshockbokbilisgodsueloperangaalisawitflythemplanbinabacrossobstacleslightsbeingiosipinakagalakanstringexplainguidewritespreadamazonpersistent,skilleviluponnungtinanggapdolyarsilid-aralanninumanhumpayyumaoninatalagalumagoexhaustionmatapacienciamaaaripingganpanunuksostarredhigitmahirappakukuluanayawmalapitpalagimakinangitakbiroconsumeoverviewanobulagkasiverdencosechasmagkaibamaghahabiisinulatkindsnitobayanibiglamanonoodbundoksumasakaykungbinibinipisokadaratingsorpresamagtigilinilagayhuwebesuncheckednaglalakadninyokagubatanperpektopumulotpabiliikatlongisasamalumiitkalabanisinusuotnalanginaabotumagangpapalapitmagsabimayroongmaliliitkasalukuyannakakaenpagkakayakapnanlilimahidpamburanagbanggaannalulungkotposporonakabulagtangnamumukod-tangihalu-halomusmospagpapasankinagalitankagandahanerlindaobserverernanghihinatinaasannagtungoikinalulungkothinipan-hipanmang-aawitatepangetpagtangispagsisisitravelphilanthropymakatarungangnakuhangthanksnawalangpamilyangluluwaspatikasamahayaangkisskahuluganhandaanpagkainisdisfrutarngumiwinaiilaganpinamalagimahiwagadaramdaminpamagatfactorespoorerpagkagisingpakikipaglabanberegningernasasalinanmaibibigayintindihinyumuyukokulunganmahalinaraw-arawngitihagdanannanangistumapospalamutikakilalagiyeranakatuontumamamahabangnakapagproposelikasligaya