Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "development"

1. A father's love and affection can have a significant impact on a child's emotional development and well-being.

2. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

3. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

4. Einstein also made significant contributions to the development of quantum mechanics, statistical mechanics, and cosmology.

5. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

6. Einstein's work laid the foundation for the development of the atomic bomb, though he later regretted his involvement in the project.

7. Einstein's work led to the development of technologies such as nuclear power and GPS.

8. Frustration can be a normal part of the learning process and can lead to personal growth and development.

9. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

10. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

11. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

12. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

13. Limitations can be viewed as opportunities for growth and personal development.

14. Microscopes have played a critical role in the development of modern medicine and scientific research.

15. Nationalism can have a positive impact on social and economic development.

16. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

17. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

18. Sa pangalan ni Apolinario Mabini binuo ang isang award ng Department of Social Welfare and Development para sa mga organisasyong may malaking kontribusyon sa pagtugon sa mga pangangailangan ng mga mahihirap sa lipunan.

19. Scientific research has led to the development of life-saving medical treatments and technologies.

20. Tesla is also involved in the development and production of renewable energy solutions, such as solar panels and energy storage systems.

21. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

22. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

23. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

24. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

25. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

26. Trump's handling of the COVID-19 pandemic drew both praise and criticism, with policies like Operation Warp Speed aiming to accelerate vaccine development.

27. Uncertainty can create opportunities for growth and development.

28. Women have been instrumental in driving economic growth and development through entrepreneurship and innovation.

Random Sentences

1. The two most common types of coffee beans are Arabica and Robusta.

2. Nasawi ang drayber ng isang kotse.

3. Biglang nagtinginan sila kay Kenji.

4. Hindi ko kayang mabuhay ng mayroong agam-agam sa aking buhay.

5. Ignorieren wir unser Gewissen, kann dies zu einem schlechten Gewissen und Schuldgefühlen führen.

6. Apa yang bisa saya bantu? - How can I help you?

7. Las redes sociales tienen un impacto en la cultura y la sociedad en general.

8. Kilala si Hidilyn Diaz sa kanyang malakas na paninindigan para sa mga kababaihan at atletang Pilipino.

9. My best friend and I share the same birthday.

10. El internet es una fuente de entretenimiento, como videos, juegos y música.

11. Gusto mong mapansin sa trabaho? Kung gayon, ipakita mo ang iyong husay at sipag.

12. Siempre hay esperanza, incluso en las situaciones más difíciles. (There is always hope, even in the most difficult situations.)

13. Musk has been involved in various controversies over his comments on social and political issues.

14. Orang tua bayi sering kali merayakan hari ulang tahun anak mereka setiap tahunnya dengan acara yang meriah.

15. Sa dapit-hapon, madalas kaming magtungo sa park para maglaro ng frisbee.

16. Wala akong maisip, ikaw na magisip ng topic!

17. Einstein's work also helped to establish the field of quantum mechanics.

18. Los héroes son capaces de superar sus miedos y adversidades para proteger y ayudar a los demás.

19. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

20. Naglipana ang mga ibon sa hardin ngayong tag-araw.

21. Sa panitikan, maaari nating makilala ang mga kilalang manunulat ng bansa, tulad ng mga makata at nobelista.

22. I used a traffic app to find the fastest route and avoid congestion.

23. Palagi niyang suot ang kanyang korona upang ipakita na siya ay makapangyarihan.

24. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

25. Einstein was a member of the Institute for Advanced Study at Princeton University for many years.

26. La seguridad y el bienestar de los agricultores y sus familias son importantes para garantizar un futuro sostenible para la agricultura.

27. Samantala sa malayong lugar, nagmamasid siya ng mga bituin sa kalangitan.

28. En España, el Día de San Valentín se celebra de manera similar al resto del mundo.

29. Jeg har aldrig mødt en så fascinerende dame før. (I have never met such a fascinating lady before.)

30. Hindi ako sumang-ayon sa kanilang desisyon na ituloy ang proyekto.

31. Dialog antaragama dan kerja sama antarumat beragama menjadi penting dalam membangun perdamaian dan keharmonisan di tengah keragaman agama.

32. Ano ho ang gusto niyang orderin?

33. Tila maganda ang panahon ngayon para sa isang mahabang lakbayin.

34. Ang kahulugan ng duli ay tinik pagka't siya ay laging nagbibigay ng ligalig sa kanyang mga kaaway.

35. Galing sa brainly ang isinagot ko sa asignatura.

36. Kapag nasa agaw-buhay na sitwasyon, kailangan nating mag-ingat at magtulungan para sa ating kaligtasan.

37. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

38. El genio de Da Vinci no solo se limitaba al arte, también tenía una mente científica y matemática muy desarrollada.

39. Nationalism can be both inclusive and exclusive, depending on the particular vision of the nation.

40. Dahil sa determinasyon sa pag-aaral, si James ay naging valedictorian ng kanilang eskwelahan.

41. Ang bagal ng internet sa India.

42. Some oscilloscopes have built-in signal generators for testing and calibration purposes.

43. Ipabibilanggo kita kapag di mo inilabas ang dinukot mo sa akin.

44. It's important to remember that April Fool's jokes should always be in good fun - nobody likes a prank that's mean or hurtful.

45. Oh Aya, napatawag ka? mejo bagsak ang boses ko.

46. The early bird catches the worm.

47. Every cloud has a silver lining

48. Ano ang malapit sa eskuwelahan?

49. I don't want to spill the beans about the new product until we have a proper announcement.

50. Masakit ba?? Tumingin siya sa akin, Masakit na naman ba??!!

Recent Searches

androidtinydevelopmentbehaviorstartedthreeaffectpacetipssalapilumiwagmaglalaropamahalaannegosyanteclubpagsumamonagmamadalikapatawaranespecializadasreserbasyonkalakihantumawagnakaka-inpaglalayagarghgupitnagpapaniwalanagpakitaunibersidadnakagalawnagtitindanagkakatipun-tiponbiocombustiblesgumagalaw-galawdevelopedtumabidalagarepublickutobisigchickenpoxnakisakaysalamintandangnavigationpagbabantatinuturototoodiinmaasahannatatawacultivationunidosumigtadipinatawagumiinomiloilofitnessikukumparanauliniganmagulayawparehongcourtmagkaibangnagmistulanghumiwalaynakapaligidkare-kareminamahaltiktok,pinalambotikawtaksiumulanmaya-mayadescargarhinugotprotegidokilaymaibigayoperativosumiwaspagongunantiemposkulangmalagosagotnilalangsumasaliwmauntogganyanplanning,anubayansementocandidatesipinansasahogdealtransportmatulungindyosakontingkriskaheartbreakmissionkuwebatokyovivasapilitangmatitigasnegosyomatayoginiisipmakulitmaisiptagalogdikyamdumaanibinalitangeclipxewastemayamanibinentaplasamanghulimatabangkumatokiniibigrenatosuccessfulisinumpapalibhasapagkaraalananumerosostwitcheffektivtillcinetiketokaybinulongmustsigahayhomestwo-partyindiainulitballcompartenfonocongratsdesdeearlymulispecializeddogshowroboticvotesdolyarbaldedownpinilingincreasinglyimagingtruetargetparteksenasedentarysumapitstrengthcountriesmakilingpinaladsinodenmasyadongbetacableroughpilingnotebookpersistent,representedfeedbackanimbehindroquesecarsebinabacrossseasiteandrewpaladsistemasyamantryghed