Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "development"

1. A father's love and affection can have a significant impact on a child's emotional development and well-being.

2. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

3. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

4. Einstein also made significant contributions to the development of quantum mechanics, statistical mechanics, and cosmology.

5. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

6. Einstein's work laid the foundation for the development of the atomic bomb, though he later regretted his involvement in the project.

7. Einstein's work led to the development of technologies such as nuclear power and GPS.

8. Frustration can be a normal part of the learning process and can lead to personal growth and development.

9. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

10. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

11. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

12. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

13. Limitations can be viewed as opportunities for growth and personal development.

14. Microscopes have played a critical role in the development of modern medicine and scientific research.

15. Nationalism can have a positive impact on social and economic development.

16. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

17. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

18. Sa pangalan ni Apolinario Mabini binuo ang isang award ng Department of Social Welfare and Development para sa mga organisasyong may malaking kontribusyon sa pagtugon sa mga pangangailangan ng mga mahihirap sa lipunan.

19. Scientific research has led to the development of life-saving medical treatments and technologies.

20. Tesla is also involved in the development and production of renewable energy solutions, such as solar panels and energy storage systems.

21. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

22. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

23. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

24. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

25. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

26. Trump's handling of the COVID-19 pandemic drew both praise and criticism, with policies like Operation Warp Speed aiming to accelerate vaccine development.

27. Uncertainty can create opportunities for growth and development.

28. Women have been instrumental in driving economic growth and development through entrepreneurship and innovation.

Random Sentences

1. Les personnes âgées peuvent faire face à la fin de leur vie avec courage et dignité.

2. Ang panitikan ay may kakayahan na magbukas ng ating isipan sa iba't ibang kaisipan at ideya.

3. Ang paggamit ng droga ay maaaring magdulot ng mga epekto sa pag-iisip, emosyon, at pisikal na kalusugan ng isang tao.

4. Tila may pagdududa siya sa katapatan ng kanyang kaibigan.

5. Walang sinuman ang nangahas na kontrahin ang plano ng kanilang lider.

6. They plant vegetables in the garden.

7. Biglaan ang pag-ulan kanina kaya ako ay nabasa nang husto.

8. Seperti makan buah simalakama.

9. Mahalaga na tuparin natin ang ating mga pangarap upang hindi natin pagsisihan sa hinaharap.

10. Nagsmile siya, Uuwi ka ha.. uuwi ka sa akin..

11. She has been exercising every day for a month.

12. They served a mouthwatering strawberry shortcake for dessert.

13. Marami rin silang mga alagang hayop.

14. There are a lot of opportunities to learn and grow in life.

15. May nagpapaypay May kumakain ng halu-halo.

16. Nakita nilang ang balat ng bunga ay manipis at maliit ang buto.

17. May sinasabi ka ba? umiling ako sa tanong ni Kenji

18. Musk's innovations have transformed industries such as aerospace, automotive, and transportation.

19. Omelettes are a popular choice for those following a low-carb or high-protein diet.

20. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

21. Hindi ko alam kung magiging okay ka dito, pero gusto ko lang itanong - pwede ba kita ligawan?

22. The love that a mother has for her child is immeasurable.

23. Sí, claro, puedo esperar unos minutos más.

24. Nagdesisyon siyang mag-iwan ng trabaho upang magtayo ng sariling negosyo.

25. Kung wala kang maayos na balak, huwag kang umasa sa magandang resulta.

26. Børn bør lære om bæredygtighed og miljøbeskyttelse for at bevare vores planet.

27. Kailan nangyari ang aksidente?

28. Si Ben ay malilimutin pagdating sa mga petsa ng okasyon, kaya lagi siyang may kalendaryo.

29. Tumingin siya saken at sa malungkot na mukah ay umiling.

30. Marahil ay maulan bukas kaya't dapat magdala ng payong.

31. Magandang gabi sa inyo mga ginoo at binibini.

32. Mahal na mahal ni Aling Rosa ang kanyang bugtong na anak.

33. Kumukulo na ang sikmura ni Jayson dahil kanina pa sya hindi kumakain.

34. Gusto ko na talaga mamasyal sa Singapore.

35. Ang mga litrato ay mahalagang bahagi ng kasal upang maalala ang espesyal na araw.

36. Eh bakit mo binili para sa kanya yun kung ganun?

37. Isang araw, ang katulong ng bagong Sultan ay humahangos at ibinalitang may isang punongkahoy na tumubo sa kinalilibingan ni Sultan Barabas.

38. Nagtagisan ng galing ang mga maghahabi.

39. Rawon adalah hidangan daging yang dimasak dengan bumbu rempah khas Jawa Timur yang berwarna hitam.

40. Hindi pa rin makapagsalita si Mang Kandoy.

41. Makikita ko ang mga kapatid ko sa pasko.

42. Kailangan na nya makuha ang resulta ng medical exam bukas.

43. Sa takip-silim, mas mahimbing ang tulog dahil sa kalmado at malamig na panahon.

44.

45. Kailangan kong hiramin ang iyong pliers para sa aking proyektong DIY.

46. Some fruits, such as strawberries and pineapples, are naturally sweet.

47. The website's content is engaging and informative, making it a great resource for users.

48. Kucing di Indonesia diberi makanan yang bervariasi, seperti makanan kering dan basah, atau makanan yang dibuat sendiri oleh pemiliknya.

49. Napatingin ako sa kanya bigla, Kenji?

50. Bilang ganting langit sa mga kabutihan nina Waldo at Busyang, sila ay pinagkalooban ng isang anak na pagkaganda-ganda.

Recent Searches

errors,developmenttabapersistent,sequebilingstopstreamingimporasinupondagatnakatunghaytumigilgovernorsobservererdatapwatnagsisipag-uwiansong-writingkaaya-ayangsumasakaykagandahanflyvemaskinerkumakapitmaliwanagmagkanonangumbidataospalasyololalalimprosesobuntismataraybeyondforskel,adangseefourtransittextolastingmagkaibiganikawmagsalitainformationayasesamepinakamahabatumikimmagagamitlikodnakaakyatsignalpagtutoltalinoagwadornami-missmalezaeducationkaninumannagtuturokaybilisdiddrewfrancisconakakatawaverylagaslasshiftkararatingtinutoppasensyasangkalanpusopagtiisanngipingkinamumuhianpocapunongkahoynothingguiltypinggankalarooperatesakristanfinishedbayaningtransportgulangfactoresbumotonahulimaligayaexhausteddi-kawasamangingisdangnakauslingvistbuwanpasalamatanmatesapagtawapiecesapologeticmalinismenospulislabingtinitirhanpinaghalonagtutulakpaboritongbumababahayaangbinge-watchingsiemprekruskumirotsangkalanelectstrengthsurgerydenjamesmuchosfonomagbabakasyongumagalaw-galawnakakunot-noongnakuhangsabadongnageenglishrevolucionadomang-aawitnagmakaawawatawatkanikanilangsunud-sunuranmontrealhandaannakayukonag-poutmakakakaenrosaskadalastahananprimerosdispositivomagkasabaynakahugemocionespasahenagpalutofulfillmentnatutuwaregulering,bakantebahagyakristoaffectnagsusulatfiverrtools,vetoanayhihigitmandirigmangteachingscrecerlugawcommunitymalayanglitsonreguleringlagiroboticlibreincreasinglymakalingumaagosimaginationmanuksoparipopularipapaputolsumakittiningnaneditormatalinowaiternapapatinginpagdamihunisisipainrenatonatulogcapacidadarkila