Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "development"

1. A father's love and affection can have a significant impact on a child's emotional development and well-being.

2. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

3. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

4. Einstein also made significant contributions to the development of quantum mechanics, statistical mechanics, and cosmology.

5. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

6. Einstein's work laid the foundation for the development of the atomic bomb, though he later regretted his involvement in the project.

7. Einstein's work led to the development of technologies such as nuclear power and GPS.

8. Frustration can be a normal part of the learning process and can lead to personal growth and development.

9. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

10. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

11. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

12. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

13. Limitations can be viewed as opportunities for growth and personal development.

14. Microscopes have played a critical role in the development of modern medicine and scientific research.

15. Nationalism can have a positive impact on social and economic development.

16. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

17. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

18. Sa pangalan ni Apolinario Mabini binuo ang isang award ng Department of Social Welfare and Development para sa mga organisasyong may malaking kontribusyon sa pagtugon sa mga pangangailangan ng mga mahihirap sa lipunan.

19. Scientific research has led to the development of life-saving medical treatments and technologies.

20. Tesla is also involved in the development and production of renewable energy solutions, such as solar panels and energy storage systems.

21. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

22. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

23. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

24. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

25. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

26. Trump's handling of the COVID-19 pandemic drew both praise and criticism, with policies like Operation Warp Speed aiming to accelerate vaccine development.

27. Uncertainty can create opportunities for growth and development.

28. Women have been instrumental in driving economic growth and development through entrepreneurship and innovation.

Random Sentences

1. Nang marating niya ang gripo ay tungo ang ulong tinungo niya ang hulihan ng pila.

2. Les étudiants doivent respecter les règles de conduite à l'école.

3. Elektronik kan hjælpe med at forbedre miljøbeskyttelse og bæredygtighed.

4. Umalis na siya kasi ang tagal mo.

5. Some businesses have started using TikTok as a marketing tool to reach younger audiences.

6. Di kalaunan, habang lumalaki ang bata, napapansin nilang ito nagiging salbahe, napakasinungaling at maramot.

7. Sang-ayon ako na dapat natin pagtuunan ng pansin ang kalagayan ng ating kalikasan.

8. Sorry.. pati ikaw nadadamay. E-explain ko na lang sa kanya..

9. Les enseignants sont souvent formés dans des écoles de formation des enseignants.

10. Ang kaulayaw ay mahalagang bahagi ng buhay ng isang tao.

11. Kung kasamaan pa rin ang nasa iyong pagiisip, sanay huwag kanang makatayo.

12. Her lightweight suitcase allowed her to pack everything she needed for the weekend getaway without exceeding the airline's weight limit.

13. Naglipana ang mga batang naglalaro sa parke ngayong Linggo.

14. Limitations can be a result of fear or lack of confidence.

15. Tak kenal maka tak sayang.

16. He does not waste food.

17. La seguridad en línea es importante para proteger la información personal y financiera.

18. Ang aming angkan ay may malaking bahagi ng kasaysayan ng aming bayan.

19. Sino-sino ang mga kaklase ni Carmen?

20. Pagkatapos mag-apply ng pabango, ang aking sarili ay naging mabango at kaakit-akit sa amoy.

21. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

22. La conciencia nos ayuda a entender el impacto de nuestras decisiones en los demás y en el mundo.

23. Kailangan ng mas magandang kondisyon sa trabaho para sa mga anak-pawis upang mapabuti ang kanilang kalagayan.

24. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

25. Ang tagumpay ng aking mga estudyante ay siyang ikinagagalak ng aking puso.

26. Andre helte arbejder hver dag for at gøre en forskel på en mere stille måde.

27. The team's performance was absolutely outstanding.

28. Napakahusay nga ang bata.

29. Don't beat around the bush with me. I know what you're trying to say.

30. Inakalang magugustuhan ng lahat ang ideya niya, pero tinanggihan ito.

31. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

32. Puwede ba akong sumakay ng dyipni?

33. Ngunit nagulat ang lahat sapagkat mul sa maruming ilog ay may maliliit na insektong lumulusob sa bayan tuwing gabi.

34. Saya cinta kamu. - I love you.

35. Los recién nacidos son pequeños y frágiles, pero llenan nuestros corazones de amor.

36. Nagngingit-ngit ang bata.

37. There are a lot of reasons why I love living in this city.

38. This has led to a rise in remote work and a shift towards a more flexible, digital economy

39. Sa dagat, natatanaw ko ang mga ibon na lumilipad sa malawak na kalangitan.

40. He applied for a credit card to build his credit history.

41. Bis morgen! - See you tomorrow!

42. Gabi na po pala.

43. La falta de vivienda adecuada y segura es un problema común para las personas pobres.

44. Ano ang nasa bulsa ng bag niya?

45. Eine hohe Inflation kann das Wirtschaftswachstum verlangsamen oder stoppen.

46. Wolverine has retractable adamantium claws and a regenerative healing factor.

47. Sa aming eskwelahan, ang mga mag-aaral ay nagtatanim ng mga gulay sa school garden.

48. Les patients peuvent être hospitalisés pour une durée variable en fonction de leur état de santé.

49. He pursued an "America First" agenda, advocating for trade protectionism and prioritizing domestic interests.

50. Ang aking kabiyak ay ang aking tahanan, kung saan ako nararamdamanang tunay na pagmamahal at suporta.

Recent Searches

developmentwaitcontrolledadaptabilityuwakcountlessskyldessimplengmuchmahiyakinakabahanpag-iyaktatlumpungsugatangtagalogpumayagligayamulamagsisineinakasaganaanngisimay-bahayhankagabicubiclebrasonatalongexpertisedrogabillartistsfulfillingnecesariotobacconatataposipinaathenasobraiskoipaliwanagsinkpabalingatpagpapakainnakakaanimdaraananenchantedsumindiberkeleyapollosecarsehidingkatolikokutodapologeticibinibigaynitongpinagwagihangtumakasstevelabastulunganpondowithoutmatiyaksamang-paladpamamahingapalmamatutongt-isapunongalitaptappaghingimaglalakadmakahiramnagmamadalikingdomnapapatungokaloobangmakikipagbabagmakikiraannakitakinamumuhiannanlilimahidnapakatagalginugunitaculturailoilopakilutotatagalpinagmamalakiihahatidkabundukanpronounpagbabantapupuntahanprimerostagaytaybutikipakikipaglabangusgusingtaga-hiroshimaleaderspagdudugopinigilannasilawleveragenakarinignag-iimbitaindustriyanamumukod-tangikanya-kanyangnationalbasketballendvideresasapakinmoodcalambamisyunerongintroductionmilyongtiemposanumanngayonumigibcandidatesdefinitivosakimmaingattiningnanbusinessessinongconnectingcongressusaomelettetinderabusognakasuotcameraeeeehhhhanaypabalangmeetraildidperlaelectionslegendsproperlycallertabimalapitfriescadenapasokrefersseparationsummitbroadcastingguiltyhapdi2001pnilitcouldlayuninerrors,computerquicklyiginitgitwindowcuandopapuntanggenerationersabogniligawanhetosnainnovationtiposrelativelybahagyamayabangbumotocafeteriahimihiyawvitaminsiglostrategiesbritishdininunmakatulogvelstandmalayongkinatatalungkuangpakikipagtagponag-aalalangpunong-kahoymulighed