Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "development"

1. A father's love and affection can have a significant impact on a child's emotional development and well-being.

2. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

3. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

4. Einstein also made significant contributions to the development of quantum mechanics, statistical mechanics, and cosmology.

5. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

6. Einstein's work laid the foundation for the development of the atomic bomb, though he later regretted his involvement in the project.

7. Einstein's work led to the development of technologies such as nuclear power and GPS.

8. Frustration can be a normal part of the learning process and can lead to personal growth and development.

9. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

10. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

11. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

12. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

13. Limitations can be viewed as opportunities for growth and personal development.

14. Microscopes have played a critical role in the development of modern medicine and scientific research.

15. Nationalism can have a positive impact on social and economic development.

16. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

17. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

18. Sa pangalan ni Apolinario Mabini binuo ang isang award ng Department of Social Welfare and Development para sa mga organisasyong may malaking kontribusyon sa pagtugon sa mga pangangailangan ng mga mahihirap sa lipunan.

19. Scientific research has led to the development of life-saving medical treatments and technologies.

20. Tesla is also involved in the development and production of renewable energy solutions, such as solar panels and energy storage systems.

21. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

22. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

23. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

24. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

25. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

26. Trump's handling of the COVID-19 pandemic drew both praise and criticism, with policies like Operation Warp Speed aiming to accelerate vaccine development.

27. Uncertainty can create opportunities for growth and development.

28. Women have been instrumental in driving economic growth and development through entrepreneurship and innovation.

Random Sentences

1. Si Ana ay marunong mag-dribble ng bola nang mabilis.

2. Ano ang binibili ni Consuelo?

3. Napansin niya ang mababa ang kita ng tindahan nitong buwan.

4. At habang lumalaki na nga ang bata ay unti-unti itong naging bihasa sa paghahabi ng mga tela.

5. Sino ang bumisita kay Maria?

6. Bigla, ubos-lakas at nag-uumiri siyang umigtad.

7. Electric cars are environmentally friendly as they emit no tailpipe pollutants and produce zero greenhouse gas emissions.

8. Sira ang elevator sa mall, kaya't napilitan silang gamitin ang hagdan.

9. Min erfaring inden for dette område har været meget givende.

10. Parang ganun na nga babes. Tapos tumawa kami.

11. Ngumiti siya at lumapit kay Maico.

12. Hindi maikakaila, mas malakas ang pamilyang magkakasama.

13. Trump was known for his background in real estate and his role as a television personality on the show "The Apprentice."

14. En ren samvittighed kan give os en følelse af ro og tilfredshed.

15. Better safe than sorry.

16. Ang tagumpay ng aking proyekto ay nagpawi ng aking mga pag-aalinlangan at pagdududa sa aking kakayahan.

17. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

18. Susunduin ni Nena si Maria sa school.

19. Después del nacimiento, el bebé será evaluado para asegurarse de que está sano y para determinar su peso y tamaño.

20. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

21. Nakakatakot ang kanilang lugar sapagkat andaming adik.

22. Doa bisa dilakukan secara individu atau bersama-sama dengan orang lain.

23. Mahalaga ang pag-aaral sa talambuhay ni Teresa Magbanua upang maipakita ang papel ng kababaihan sa himagsikan.

24. Teka, pakainin na muna natin sila. ani Jace.

25. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

26. Nagsusulat ako ng liham upang ipahayag ang aking pasasalamat.

27. Bago ang kasal, nagkaruon muna sila ng seremonya kung saan nagmamano siya bilang bahagi ng pamamamanhikan.

28. Kumain na ako pero gutom pa rin ako.

29. Sino-sino ang mga inimbita ninyo para manood?

30. She has been baking cookies all day.

31. Isang araw, isang matanda ang nagpunta sa bahay ng bata at hinamon niya ito.

32. Emphasis can be used to create a sense of drama or suspense.

33. Penting untuk memiliki pola pikir yang fleksibel dan terbuka dalam menghadapi tantangan hidup.

34. Sweetness can be a source of comfort and pleasure for many people.

35. Kakutis ni Kano ang iba pa niyang kapatid.

36. At have en træningsmakker eller træningsgruppe kan hjælpe med at øge motivationen og fastholde en regelmæssig træningsrutine.

37. Ngunit wala siyang nararamdaman sakit.

38. El acceso al agua potable es un derecho humano fundamental.

39. Hinugot niya ang kanyang karanasan sa trabaho upang makapagsimula ng sarili niyang negosyo.

40. Fødslen kan føre til forskellige fysiske forandringer i kroppen, og genopretningstiden varierer fra person til person.

41. Madalas siyang sumusulat kapag nag-iisa.

42. Mula noon ay laging magkasama ang dalawa.

43. Hinalungkat na niya ang kahong karton na itinuro ng ina.

44. Paparami iyon at pumapaligid sa kanya.

45. Bilang paglilinaw, ang pondo para sa event ay galing sa donasyon, hindi mula sa pondo ng paaralan.

46. Ito'y hugis-ulo ng tao at napapalibutan ng mata.

47. Gusto ko sanang ligawan si Clara.

48. Mencapai tujuan dan meraih kesuksesan dapat memberikan perasaan kebahagiaan yang mendalam.

49. Baka naman nag message na sayo, hinde mo lang alam..

50. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

Recent Searches

developmentipinalitwindowsolidifyneedscourtnakabiladpaksasettingeksport,online,ipagbilinagmasid-masidtsonggopollutionmustpagsasalitaumilingtravelcultureminamahalmakapalagmakalipasmatalinotatlumpungkapamilyapronounmagbagong-anyooktubrekawili-wilinamumulaklakpagkamanghamakapangyarihangnangampanyaginugunitaagricultoresmagsalitanag-aalalangfysik,evolucionadostaynapakabilislalabasnakilalataxipagbabayadmagbaliktaglagasflamenconagpabayadnagsagawagulataanhinpanghabambuhaypapagalitankatawangartistasnapakahusaypapanhikhulunakakainkisskuryentenamataymakukulaymakasalanangnandayapahiramtatagalpalayokproducerercombatirlas,bayadpagdiriwangtotoolansanganmasaganangregulering,kaliwatig-bebeinteumuponaawahinalungkatmaskinermaynilanatitiyakpaglingonmatagumpayjeepneypigilanpangalanankatibayanghatinggabitraditionalgrocerykundimanunangde-latanakaindumilatpamanpangkatdeterminasyonsuwailexpresansisidlanarkilasadyangrabbapaldaopobuwayadiseaseaguatanganprobinsyamabutirepublicanabigaelperseverance,maglabakinalimutannakasaraadvanceinangginaganooncarbonbumilinenakasaysayantinitindalapatlivesdogskikoleadingapoygodtlookedoutlinecoalmarmaingltofar-reaching1929hehelettersalarincalciumaudiencetapemangingisdasigeahitterminoarghtuwangespigassubalitmasseswalnglingidpangingimijacewidespreadshortschoolsroonhigitdisappointknownbarnessakinulamlabasleesurgerymalapitchessfiguresinterestknowsmentalbumugabinabalikipinabalikpatulogexcuseresourcesroqueapollomobiledarkstylessingereducationalalinthereforebubong