Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "production"

1. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

2. Adopting sustainable agriculture practices can help reduce the environmental impact of food production.

3. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

4. L'intelligence artificielle peut aider à optimiser les processus de production industrielle.

5. She began her career in musical theater and appeared in the Broadway production 13 in 2008.

6. Tesla has faced challenges and controversies, including production delays, quality control issues, and controversies surrounding its CEO, Elon Musk.

7. Tesla is also involved in the development and production of renewable energy solutions, such as solar panels and energy storage systems.

8. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

9. Tesla's Gigafactories, such as the Gigafactory in Nevada, are massive production facilities dedicated to manufacturing electric vehicle components and batteries.

10. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

11. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

Random Sentences

1. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

2. The cake was so light and fluffy; it practically melted in my mouth.

3. Bumibili ako ng maliit na libro.

4. She has adopted a healthy lifestyle.

5. Matumal ang mga paninda ngayong lockdown.

6. Malapit na naman ang eleksyon.

7.

8. Umiiyak ang langit sapagkat tuyo na ang lupa.

9. Kevin Durant is a prolific scorer and has won multiple scoring titles.

10. Hendes hår er som silke. (Her hair is like silk.)

11. Trump's foreign policy approach included renegotiating international agreements, such as the North American Free Trade Agreement (NAFTA) and the Paris Agreement on climate change.

12. Magic Johnson was a skilled playmaker and led the Los Angeles Lakers to multiple championships.

13. Nagngingit-ngit ang bata.

14. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

15. Tumama ang aming kapitbahay sa lotto.

16. Les enfants commencent l'école maternelle à l'âge de 3 ans.

17. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

18. Holy Week påskeugen er den vigtigste religiøse begivenhed i den kristne tro.

19. Nagplano akong maglakad-lakad sa park, datapwat bigla akong tinawagan ng aking kaibigan para magkape.

20. The children play in the playground.

21. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

22. Nagsusulat ako ng mga pangako sa aking mga minamahal sa mga espesyal na okasyon.

23. Upang makatiyak, isinama ng datu ang pinakamatapat na kawal nang dumating ang ikatlong gabi.

24. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

25. Napuyat na ako kakaantay sa yo.

26. Naglalaway ang mga tao sa pila habang nag-aabang sa paboritong fast food chain.

27. Pagkatapos ng isang daang metro kumanan ka.

28. No hay palabras suficientes para agradecer tu amor y apoyo.

29. Les régimes riches en fruits, légumes, grains entiers et faibles en graisses saturées peuvent réduire le risque de maladies chroniques.

30. Congress are elected every two years in a process known as a midterm election

31. Tila nagbago ang ihip ng hangin matapos ang kanilang pag-uusap.

32. At have et håb om at blive en bedre person kan motivere os til at vokse og udvikle os.

33. Bagaimanakah kabarmu hari ini? (How are you today?)

34. La boda de mi amigo fue una celebración inolvidable.

35. When we read books, we have to use our intelligence and imagination.

36. Ang hindi magmahal sa sariling wika ay higit pa sa hayop at malansang isda.

37. Sa bawat kompetisyon, dala ni Hidilyn Diaz ang pagmamalaki at pagmamahal niya sa Pilipinas.

38. Nang biglaang magdidilim ang paligid, nahirapan akong makita ang daan pauwi.

39. No puedo creer que ya te vas, cuídate mucho y no te olvides de nosotros.

40. Nagitla ako nang biglang bumagsak ang mga plato sa kusina.

41. Dogs can be trained for a variety of tasks, such as therapy and service animals.

42. Lazada has faced criticism over counterfeit products being sold on its platform.

43. Las hojas de otoño son muy bonitas en la ciudad.

44. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

45. Hindi maitatago ang hinagpis ng bayan sa pagkamatay ng kanilang minamahal na lider.

46. A lot of snow fell overnight, making the roads slippery.

47. Bakit ka tumakbo papunta dito?

48. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

49. La comida que preparó el chef fue una experiencia sublime para los sentidos.

50. Inakalang hindi na darating ang bus, kaya naglakad na lamang sila.

Recent Searches

abigaelproductionpioneeruhogtssstripnasaangdumilatbalancesmagtagoattractivenakatindigbalekabighaprotegidorisenasaantog,tinutophunimagkaparehootrastodotingtimetililikelytilatexttaostaontalepinanalunantagatabamaanghangstaysongsawamagisingnilolokocommunicationseksenanatayoikinamataykapwayelosama18tholiviaisaatabumugakaybilisininommabutingreloalmacenarratepunoparaokaynunopulaagosattentionlookedpulitikonungpagpapakalatmakalipasinspiremagpa-ospitalmapahamaknapililaryngitishundredstorenagcurvemisamanyloobabenemaglabaahitnapansinutilizamoodbataynakauslingguiltybetweeniniisipintindihinaywanforskellivelawslastlandlalamamayaabanganlackkunekitakinakayocoinbasekangkriskaxixnagtapospangakosensiblekanawalletmanilagrammardisfrutarhamakreservesdahonmotioninuminpagkaraadiinjokedealpabalingatjenasamantalangdaanitakchoibutihopeskillssulyapclockmagkaibangbadingmagdaanbasahanbilibiduntimelyagilitysasabihinbulalintanapabalikwasbubonganubayanhongbilihomeballhalagoalawayginalawayandyalingearaloksiyagawatinataluntonaguagaganaghihirapsourcesnaiinggitemphasizedmakapilingagadmanuksouugod-ugodnag-aaralnalulungkotnagbasateachumiiyakbroadcastdingginbehalfyeshanapbuhayusetootipsigpaaoponinaisnasmgapanataglee