Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "production"

1. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

2. Adopting sustainable agriculture practices can help reduce the environmental impact of food production.

3. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

4. L'intelligence artificielle peut aider à optimiser les processus de production industrielle.

5. She began her career in musical theater and appeared in the Broadway production 13 in 2008.

6. Tesla has faced challenges and controversies, including production delays, quality control issues, and controversies surrounding its CEO, Elon Musk.

7. Tesla is also involved in the development and production of renewable energy solutions, such as solar panels and energy storage systems.

8. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

9. Tesla's Gigafactories, such as the Gigafactory in Nevada, are massive production facilities dedicated to manufacturing electric vehicle components and batteries.

10. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

11. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

Random Sentences

1. Miss, nakalabas na ba yung pasiyente dito?

2. Ang buhawi ay maaaring magdulot ng pagkalbo sa mga puno, pagbagsak ng mga poste ng kuryente, at iba pang pinsala sa imprastruktura.

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

5. Some ailments are contagious and can spread from person to person, such as the flu or COVID-19.

6. Ang pagkakaroon ng malakas na lindol ay binulabog ang mga gusali at nagdulot ng takot sa mga tao.

7. Has she written the report yet?

8. Pagkatapos nila mag-usap at pagkapasok ni Helena sa kanyang kwarto ay nilapitan ni Haring Bernardo ang binata at kinausap ito

9. Nagiging emosyonal ang mga panahon sa kasal, tulad ng mga pananalita ng mga magulang at mga kaibigan.

10. The scientific consensus is that vaccines are safe and effective in preventing the spread of disease.

11. Nagbabaga ang pakiramdam ng kanyang balat dahil sa matagal na pagkabilad sa araw.

12. Kapatid mo ba si Kano? isasabad ng isa sa mga nasa gripo.

13. Napansin ng mga paslit ang nagniningning na baston ng matanda.

14. Dogs are social animals and require attention and interaction from their owners.

15. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

16. Waring may kakaibang nararamdaman siya, ngunit hindi niya ito maipaliwanag.

17. Elektroniske apparater kan hjælpe med at forbedre kommunikation og forbindelse med andre mennesker.

18. Ang kanyang boses ay napakahinahon at mababa.

19. La esperanza es lo que nos mantiene adelante en momentos difíciles. (Hope is what keeps us going in difficult times.)

20. Umihip ang malamig na hangin, waring may paparating na masamang balita.

21. En boca cerrada no entran moscas. - Silence is golden.

22. Kahit na lilipad ang isip ko'y torete sa'yo.

23. The restaurant messed up his order, and then the waiter spilled a drink on him. That added insult to injury.

24. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

25. Es importante evitar rascarse o manipular las heridas para facilitar su cicatrización.

26. The church organized a charitable drive to distribute food to the homeless.

27. ¿Qué le puedo regalar a mi novia en el Día de San Valentín?

28. Sa pagkawala ng kanilang tahanan, naghihinagpis ang mga pamilyang apektado ng sunog.

29. Pakibigay sa amin ang detalyeng kailangan para maayos naming magawa ang proyekto.

30. Mahalaga ang pagkakaroon ng kalayaan sa edukasyon upang mapalawak ang ating kaalaman at pag-iisip.

31. Makikiraan po!

32. Si Maria ay na-suway sa utos ng guro na tapusin ang kanyang takdang gawain.

33. Marahil ay nasa ibang bansa ang artista kaya't hindi mo siya maaaring makita sa personal.

34. Maaf, saya tidak mengerti. - Sorry, I don't understand.

35. Magkita po tayo pagbisita ko riyan.

36. Limitations can be overcome through perseverance, determination, and resourcefulness.

37. Nous allons faire une promenade dans le parc cet après-midi.

38. Einstein was offered the presidency of Israel in 1952, but declined the offer.

39. Huwag kang pumasok sa klase!

40. The use of emphasis is influenced by cultural and social norms.

41. Eine gute Gewissensentscheidung zu treffen, erfordert oft Mut und Entschlossenheit.

42.

43. Ang mga estudyante ay pinagsisikapan na makapasa sa kanilang mga pagsusulit upang maabot ang kanilang mga pangarap.

44. Viruses can be used as vectors to deliver genetic material into cells, which can be used to treat genetic disorders.

45. Salamat at hindi siya nawala.

46. Nakakalungkot isipin na hindi na ako makakapakinig ng bagong awitin mula sa Bukas Palad dahil sa pagkawala ni Fr. Manoling.

47. Bilang pasasalamat, si Hidilyn Diaz ay nagbigay ng inspirasyon sa pamamagitan ng motivational talks.

48. My daughter is in her school play tonight - I told her to break a leg.

49. And dami ko na naman lalabhan.

50. Ang ganda pala sa enchanted kingdom!

Recent Searches

productionatentoseeveryartsahitbienspeecheskanilaexperiencesdaanglatercalleroutlinesicontvsnothingpowersipasokcommunicationspressteamresponsiblebinasasourceulingconstitutionrefnapakalakinggraduallyactorlearnexamplekanocenterkunwana-curiousnag-iisasinakopteachingsglobalnabuhaymagtakamakapag-uwireboundattentionmakasilongferrerprivatemestloanshuertoshoppinghahatolpamasahestordomingodeterminasyonpierlugarbangkangkaninarawtaposmagkanomasayahindalirimalulungkotpag-uwishinescorporationwalkie-talkiekuligligevenfredheietograbeauthorexitboyataquescountriesspeedtravelernagwelgangingisi-ngisingnagre-reviewnapakagandangmagkasintahannakatuwaangpagkamanghanagkakasyasportsnatanggappinagsikapanpotaenanegro-slavesunahinmagkapatidpagpilisimbahangulatskills,tatawagannapapasayapamilyangnapakagagandaherundertumatanglawmakikiligoromanticismopalancapagkasabinagmadalingnanlakiatensyongmagtataaskanikanilangnagmistulangmahuhulinapakabilispasaheronanonoodnakilalamangyarinapahintonatatawakuripotfactoresvidenskabrichkondisyonpinigilandispositivohulutv-showslabinsiyamnagdadasalbisitanamatayforskel,nareklamoapatbiyasmahahawatanghalivictoriabilihintradisyonproducererpantalonindustriyanakaakyatcombatirlas,gumigisingvegasebidensyaginoongfollowedtiranglalotakotporxviiemocioneskalabanlugawlalakingadecuadoflamencotagakdisciplinalagaomfattendeannikabayaningcredittatlongninaanaybingimukapabalangalaalamalihismalayanglumulusobkinantakahilingankaarawankasoylihimnamulatpublicitysumpainpinalayasnaalisisinumpagrowth