Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "same"

1. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

2. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

3. John and Tom are both avid cyclists, so it's no surprise that they've become close friends - birds of the same feather flock together!

4. Many politicians are corrupt, and it seems like birds of the same feather flock together in their pursuit of power.

5. My best friend and I share the same birthday.

6. My brother and I both love hiking and camping, so we make great travel companions. Birds of the same feather flock together!

7. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

8. The members of the knitting club are all so kind and supportive of each other. Birds of the same feather flock together.

9. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

10. This can include reading other books on the same topic, interviewing experts, or gathering data

11. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

12. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

Random Sentences

1. Ang Chinese New Year ay nagpapahayag ng pag-asa at pagbabago para sa bagong taon.

2. Ang pag-aaway ng magkasintahan ay hindi tama, at mas maganda ang pag-uusap para malutas ang mga problema.

3. Nagtalaga sila ng mga dibisyon kung saan maninirahan ang bawat hayop.

4. Inutusan niya si Pinang na magluto ng lugaw.

5. Mabait ang mga kapitbahay niya.

6. They have been volunteering at the shelter for a month.

7. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

8. Eine Inflation kann die Verbraucher dazu veranlassen, Waren und Dienstleistungen zu kaufen, bevor die Preise weiter steigen.

9. Tinulungan ko siyang dalhin yung mga plato sa dining room.

10. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

11. Einstein's legacy continues to inspire and influence scientific research today.

12. Ang tagtuyot ay nagdulot ng krisis sa agrikultura sa buong rehiyon.

13. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

14. Me siento caliente. (I feel hot.)

15. En invierno, se encienden chimeneas y estufas para mantener el calor en las casas.

16. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

17. Nogle lande og jurisdiktioner har lovgivning, der regulerer gambling for at beskytte spillerne og modvirke kriminalitet.

18. En helt kan være enhver, der hjælper andre og gør en positiv forskel.

19. The symptoms of leukemia include fatigue, fever, and easy bruising or bleeding.

20. Ibinigay ko ang aking panalangin at dasal para sa mga nangangailangan ng tulong.

21. Gusto kong sumama sa nanay ko sa tindahan.

22. Ultimately, Christmas is a time of unity and togetherness, bringing people of all backgrounds and beliefs together to celebrate the spirit of love and hope.

23. Sumakit ang tiyan ko kagabi kaya ako ay biglaang nagka-sick leave.

24. Ang mga marahas na laban sa karapatang pantao ay dapat labanan at iwaksi.

25. Maganda ang mga bulaklak sa tagsibol.

26. Mabilis na pinabulaan ni Paniki na siya as isang mabangis na hayop; siya raw ay isang ibon.

27. Les enseignants jouent un rôle important dans la réussite des étudiants.

28. Athena.. malapit na tayo.. konting tiis na lang..

29. Supportive care, such as blood transfusions and antibiotics, may be necessary to manage complications of leukemia treatment.

30. Anong lugar ang pinangyarihan ng insidente?

31. Ang daming pusa sa bahay nila Jocelyn.

32. Mahigit sa pitong libo ang isla sa Pilipinas.

33. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

34. Amazon's headquarters are located in Seattle, Washington, but it has offices and facilities worldwide.

35. Our relationship is going strong, and so far so good.

36. Ang mga kasiyahan at salu-salo sa hapag-kainan ay nagdudulot ng kasiyahan sa bawat tahanan tuwing Chinese New Year.

37. Las escuelas promueven la inclusión y la diversidad entre los estudiantes.

38. Bigyan mo ng pera ang kapatid mo.

39. Después del nacimiento, la madre necesitará tiempo para recuperarse y descansar, mientras que el bebé necesitará atención constante y cuidado.

40. Nanghihinamad at naghihikab na iniunat ang mahahabang kamay.

41. The police were trying to determine the culprit behind the burglary.

42. Umalis siya upang hanapin ang sandok na hinahanap.

43. Siya ay mayabang at masyadong malaki ang pagkakilala sa sarili

44. Maraming aklat ang naisulat tungkol kay Apolinario Mabini at ang kanyang kontribusyon sa kasaysayan ng Pilipinas.

45. Riega el maíz regularmente y asegúrate de que el suelo esté siempre húmedo

46. At sana nama'y makikinig ka.

47. Sa tuwing may malaking okasyon, ginaganap ang ritwal ng pagtawag sa mga ninuno upang humingi ng gabay.

48. Ang yaman naman nila.

49. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

50. The website's social media buttons make it easy for users to share content on their social networks.

Similar Words

eksamenkisameSesame

Recent Searches

efficientsamefutureexistprotestaallowslibromarkdenhimigkwebanoelpangangatawanlackmarahasbowlmaismawawalakundimannunohundredkalabanpeacepinagsasabiasongakongproblemaeffort,rolledroseeyei-rechargeayosbagkus,sisentabirodetallansinisirapancitkagalakanshouldbwahahahahahapanunuksolayuninadvancedrenatomachinesibinilistevepeternagwelgagawainnicetsinahumpaychadhigantepinagwikaankaliwanapakabilispakukuluanautomatiskhinihintaytumatakbopabulongtaga-ochandodropshipping,bababumilimagnifykumbentopalakalalakebundoknararapatrestawrano-orderomgdulotyepdiagnosticnasabingblusangsolarweresipapalipat-lipatnakikini-kinitamerchandisetumatawagmahinangexhaustionkamakailanmorningpaki-drawingtumagalnakikiapahahanapnamulatalikabukinhumalakhakobserverernakagalawmakapangyarihanpodcasts,befolkningen,pagkapasoknangangaraldisenyongmiramanggagalingnakasahodnakatiranglihimmagtagoipinatawagprodujonagdabogsumusulatapatnapunamataypacienciaartisthumihingihinamakemocioneskinakainnagwikangsakalingisasamapasasalamatorkidyastinanggalbook,nakainnatalosampungisinamaeksport,pagbatimbricoskirbynagsalitajamesnababalotrecibirbiyernesmatulunginnangingilidgawaundeniablemassachusettsfollowedgurosiramariloukaraniwangmaibabalikalleumigibumibigwastepaskongmatatalinokasaysayanwikapulislilypagputikombinationdaladalaiilanparoinantaymaulittinitirhanpakilutotalentmaskitoothbrusheventsarghwestbagyoanimoylamanadversebranchculturamightnagbungawaliscryptocurrency:barnesformsnamshowscontestbinibiniperang