Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "same"

1. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

2. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

3. John and Tom are both avid cyclists, so it's no surprise that they've become close friends - birds of the same feather flock together!

4. Many politicians are corrupt, and it seems like birds of the same feather flock together in their pursuit of power.

5. My best friend and I share the same birthday.

6. My brother and I both love hiking and camping, so we make great travel companions. Birds of the same feather flock together!

7. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

8. The members of the knitting club are all so kind and supportive of each other. Birds of the same feather flock together.

9. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

10. This can include reading other books on the same topic, interviewing experts, or gathering data

11. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

12. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

Random Sentences

1. Kahit siya ang nauna ay lagi siyang inuunahan ni Ogor sa pagsahod.

2. Masarap higupin ang mainit na tsokolate sa malamig na gabi.

3. Ano ang gagawin mo sa Linggo?

4. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

5. La música también es una parte importante de la educación en España

6. Aksidente niyang nasira ang kanyang cellphone dahil nahulog ito sa banyo.

7. The exhibit features a variety of artwork, from paintings to sculptures.

8. Binibigyang halaga ng mga Pilipino ang talambuhay ni Ninoy Aquino bilang isang martir at simbolo ng demokrasya.

9. In 2010, LeBron made a highly publicized move to the Miami Heat in a televised event called "The Decision."

10. Bawal magpakalat ng mga pekeng balita dahil ito ay maaaring makapagpahayag ng maling impormasyon.

11. Ang saranggola ay gawa sa papel, kawayan, at plastik.

12. Gracias por hacer posible este maravilloso momento.

13. Subalit kinabukasan, matapos isuga ang kalabaw ay bayawak naman ang napagtuunan ng pansin ng batang sutil.

14. Kinaumagahan ay wala na sa bahay nina Mang Kandoy si Rabona.

15. La habilidad de Leonardo da Vinci para crear una ilusión de profundidad en sus pinturas fue una de sus mayores aportaciones al arte.

16. Noong unang panahon may nakatirang mag-ina sa isang malayong pook.

17. Nangahas siyang sumagot sa guro nang hindi nag-iisip, kaya siya napagalitan.

18. La pobreza es un problema que afecta a millones de personas en todo el mundo.

19. Robert Downey Jr. gained worldwide recognition for his portrayal of Iron Man in the Marvel Cinematic Universe.

20. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

21. She has been working on her art project for weeks.

22. He is also relieved of the burden of needless expenses and ultimately becomes a happier and healthier citizen

23. La desigualdad económica y social contribuye a la pobreza de las personas.

24. Mahirap kausapin ang mga taong maarte dahil sa kanilang pagiging kritikal sa bawat bagay.

25. Nasa unibersidad si Clara araw-araw.

26. Nakasama umano sa listahan ng mga apektado ang ilang barangay sa lungsod.

27. "Let sleeping dogs lie."

28. Hindi ko inakalang siya ang nangahas na maglagay ng graffiti sa pader ng paaralan.

29. Ok na sana eh. Tinawanan pa ako.

30. Ang tunay na kayamanan ay ang pamilya.

31. Tila masaya siya, ngunit may lungkot sa kanyang mga mata.

32. Lumibot siya sa buong paligid ng ospital upang alamin ang mga pasilidad na maaaring magamit ng kanilang pasyente.

33. Nasa labas ka ba? Teka puntahan kita dyan.

34. Kailangan nating magsumikap datapapwat marami tayong mga hamon sa buhay.

35. Sa paaralan, mahigpit na ipinagbabawal ang anumang uri ng abuso laban sa mga mag-aaral.

36. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

37. L'intelligence artificielle peut aider à prédire les comportements des consommateurs et à améliorer les stratégies de marketing.

38. Bestida ang gusto kong bilhin.

39. Sa huling pagkakataon ang mga isda ay nagsalita.

40. Pakibigay ng pagkakataon ang lahat na makapagsalita sa pulong.

41. Ada juga tradisi memotong tali pusar setelah kelahiran, yang dianggap sebagai tindakan penting untuk menjaga kesehatan bayi.

42. Maraming hindi sumunod sa health protocols, samakatuwid, mabilis kumalat ang sakit.

43. Ang mga pag-aaral sa kalusugang pang-mental ay nagbibigay-diin sa kahalagahan ng kamalayan sa mga isyu ng mental na kalusugan.

44. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

45. Les patients peuvent être transférés dans des unités de soins spécialisées en fonction de leur état de santé.

46. Some limitations can be temporary, while others may be permanent.

47. Scientific research has led to the development of life-saving medical treatments and technologies.

48. Have you been to the new restaurant in town?

49. Einstein's intellectual curiosity, creativity, and persistence in the face of challenges serve as a model for aspiring scientists and scholars.

50. Maraming misteryo ang bumabalot sa kanilang lugar.

Similar Words

eksamenkisameSesame

Recent Searches

sametumabilalawiganbakaeventsnganginternetdiscoveredtanawinafterwineoraspasanmalumbaypagdidilimpagongbigkisbumangonwalangfilipinakatipunanselebrasyonbatiindividualpag-akyatbagkusgoodsarilingnakakunot-noongnaisbabaejigsnagpanggapmasayanggananghabangchavitmag-aaralkaraniwangpag-aalalafridaysupilinkuwebapasswordhiramyakapmakangitinuevostamadkinalimutanskillshayopnagtatampofremtidigenakukulilidistanceshiniritricafuelkamaimportantmuntikannakatanggapsasailalimpagodpootpinakinggangusting-gustorepublicanputoltaxinagpaiyakbathalamatatalimmagpahingapigingkapit-bahaysisipainvenusnagtawananmag-asawamagtiwalamasayang-masayangkulunganmalasdumatingpangarapnahintakutandevelopmentpagkamanghatulongbisigagwadorochandotumalabsarapusekalayaannagpapaniwalasamakatwidnagpapaigibku-kwentaeachnaka-smirkindustryimprovedmagalitemphasisnagsasagotlikuranpagkalipasinspirehudyatnatatawanalalabingfindemayokendidugobehalfkahirapanmaalikabokakmainistwo-partyna-fundpabigatnapakahusaystoplightpawispaghahabikare-karepagkababakawili-wiliamazonkasitamisilingbienpuliskolehiyohouseholdwaiterbalikatpinagtabuyannanahimikzoommalapitmatutolitsonbayawakmakapaghilamossteeripinanganakleadpaginiwanbarroconagtinginansipagskabtiyonbabeinternaipalinistuloysafemag-anakpumupuripumayagbeseskanyanghanap-buhayturonclientemapaanongmamahalinuulaminnasasaktannagaganapcontentlahatnohestablishnandiyankitaelectionsbinigyanaddpahingamayabonglongwonderskayakahoykasalefficienttheirdamaso