Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

2. Morning.. sabi niya na halos parang ang hina niya.

3. Nasa loob ng bag ang susi ko.

4. Bilang paglilinaw, ang pondo para sa event ay galing sa donasyon, hindi mula sa pondo ng paaralan.

5. Einstein was a pacifist and spoke out against war and violence throughout his life.

6. ¿Cuántos años tienes?

7. Si Rizal ay kilala sa kanyang pagiging makatarungan at pagiging boses ng mga walang tinig sa kanyang panahon.

8. Aku sangat sayang dengan kakek dan nenekku. (I deeply love my grandparents.)

9. Mi novio me sorprendió con un regalo muy romántico en el Día de los Enamorados.

10. Sumakay ako ng taksi papuntang airport.

11. Nag-aapuhap siya ng dispensa mula sa simbahan para sa kanyang mga nagawang kasalanan.

12. Pedro at Juan ang mga pangalan ninyo.

13. Thank God you're OK! bulalas ko.

14. Ang talambuhay ni Gregorio del Pilar ay nagpapakita ng kanyang katapangan sa laban para sa kalayaan ng bansa.

15. Congress, is responsible for making laws

16. Hindi mo alam kung maarte siya o hindi dahil hindi siya masyadong nakikihalubilo sa ibang tao.

17. Mahal ko ang pusa ko dahil malambing siya.

18. Ang kalayaan ay hindi dapat magresulta sa pagpapahirap sa ibang tao.

19. Handa ko pong gawin ang lahat para lang tuparin Mo po ang aking kahilingan.

20. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

21. Huh? umiling ako, hindi ah.

22. Ako naman, poker face lang. Hahaha!

23. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

24. The relationship between work and mental health is complex and can vary from person to person.

25. Sa mga basurahan, naglipana ang mga langaw na nagiging sagabal sa kalinisan.

26. Platforms like Zoom and Skype make it easy to connect with students or clients and provide your services

27. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

28. She has quit her job.

29. Il est important d'avoir une compréhension des probabilités et des cotes lorsque l'on joue.

30. La esperanza y los sueños son una parte importante de la vida. (Hope and dreams are an important part of life.)

31. I-google mo na lang ang mga tanong na hindi mo maintindihan.

32. Ang mga puno at halaman ay nag po-produce ng oxygen.

33. Binanggit ko na sa kanila ang aking pagtutol sa kanilang desisyon ngunit hindi nila ako pinakinggan.

34. They must maintain transparency and communicate with their constituents to build trust and ensure representation is effective.

35.

36. Les devises étrangères sont souvent utilisées dans les transactions internationales.

37. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

38. Efter fødslen kan der være en følelse af lettelse og glæde over at have en ny baby.

39. Ang pagsisindi ng kandila tuwing gabi ay naging isang ritwal na nagbibigay ng katahimikan sa kanyang isip.

40. Quiero tener éxito en mi carrera y alcanzar mis metas profesionales. (I want to succeed in my career and achieve my professional goals.)

41. Naiinggit ako sa ibang hayop at halaman na tuwang-tuwa kapag may handaan sa kagubatan.

42. Bakit ka tumakbo papunta dito?

43. The stock market is a platform for buying and selling shares of publicly traded companies.

44. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

45. La escasez de agua es un desafío global que afecta a muchas regiones del mundo.

46. Hindi dapat nating pabayaan ang ating mga responsibilidad sa buhay, samakatuwid.

47. Nagsagawa ng seminar ukol kay Marites sa pangangalaga niya ng kalikasan.

48. Forgiveness allows us to let go of the pain and move forward with our lives.

49. The stuntman performed a risky jump from one building to another.

50. Vaccines are available for some viruses, such as the flu and HPV, to help prevent infection.

Recent Searches

bumisitafollowing,sparepagkasabikuwadernopagtutolnakatagolabisnyasalbahengsasakyantumawakisssuedeklasrumtoretenagwalisnapabalitagumalacirclecausespangakoblendtransportmidlerproducerertaglagasumigtadkampanaproducts:pinakamasayabukabetweentumahimiksumpainspeechsinusuklalyanshopeeincrediblemagpakaramiisinamana-curiousproductspinakamatabangpasalamatanhappierpananakitpagpapatubopagkalitophilippinerememberedsalatinhumabolnapalitangnapakabangonapaaganagpapaigibtelefonenergimatigasmuyangalmaistorboisinusuotinsektoibabahistorydressbateryabarreraspsssnakatoysalataumentaractivitypopularizefuelgoalbestlinawtoothbrushplaceomelettecivilizationdiamondmentalnowsusunduinespadamoodkalupiprusisyonbackstylesumilingmichaelposterpuedescharitablespecificregularmenteelectednatinglutosonidocebuhinintaylumisantanghalipagkakapagsalitapag-aapuhapdinaluhannagcurvedaanbirthdaynagawangbayaranangkingsensiblenagsinepaghakbangsarilieksamennaidlipmagkabilangtengamalikotpulaadabarcelonaalignslibrebantulotadditionallyauditpagbahingfacilitatingeditorbangsakinpasasalamatyumaonapasubsobnagwagimagandangkagipitantuwangpagkakayakapbinawianumabotnaglulusakunanyunmagkasintahannagsisipag-uwiannakakatulongkatawangtreatssalegraphickinauupuangpapagalitankasamahantinawagmatiyakininomtinakasannakaraanmahahalikflyvemaskinerdoble-karaibakainnatinagnangapatdantinahakkatutubonamumulatuwagovernorspapayasisikatgawaingmaghilamosmataraysumingitcnicoaddictionyeymabutivariedadsakaypakibigayandreaninyonoongcareerkenjiobtenergabriel