Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Sa kanyang hinagpis, tahimik na pinahid ni Lita ang luhang pumapatak sa kanyang pisngi.

2. Min erfaring har lært mig, at det er vigtigt at have en god arbejdsetik.

3. Medarbejdere kan blive tildelt forskellige arbejdstider, som natarbejde.

4. Trump's presidential campaigns in 2016 and 2020 mobilized a large base of supporters, often referred to as "Trumpism."

5. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

6.

7. Women's clothing and fashion have been influenced by cultural and historical trends, as well as individual expression.

8. The scientific community is working to develop sustainable energy sources to combat climate change.

9. May mga taong may agam-agam sa mga pangarap nila sa buhay kung ito ba ay magkakatotoo o hindi.

10. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

11. Las heridas por quemaduras pueden necesitar de tratamientos específicos, como el uso de cremas o apósitos especiales.

12. The goal of investing is to earn a return on investment, which is the profit or gain earned from an investment.

13. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

14. Miguel Ángel es conocido por sus esculturas, pinturas y arquitectura.

15. Durante las vacaciones, nos reunimos alrededor de la mesa para compartir historias y risas con la familia.

16. Hindi ako sang-ayon sa mga desisyon ng aking mga magulang tungkol sa aking buhay.

17. Hinugot niya ang kanyang bag sa ilalim ng mesa.

18. Tesla has faced challenges and controversies, including production delays, quality control issues, and controversies surrounding its CEO, Elon Musk.

19. He cooks dinner for his family.

20. Trump's administration faced scrutiny and investigations, including the impeachment process in 2019 and 2021.

21. Naalala nila si Ranay.

22. Matagal ng tradisyon ng mga Pilipino ang pagsamba sa poong Nazareno.

23. Different types of work require different skills, education, and training.

24. Agad naman na ngpunta si Aling Edna sa bahay nila na daladala ang parte nila sa napaghatian na gulay at bigas.

25. Sa lipunan, ang pagiging marangal at matapat ay dapat na itinuturing at pinahahalagahan.

26. Cheating is the act of being unfaithful to a partner by engaging in romantic or sexual activities with someone else.

27. Nang umibig siya sa taga-lupang si Ramon, ang kanyang pagka-diwata'y tinalikdan niyang lubos upang mamuhay bilang ganap na tao.

28. Las heridas superficiales pueden ser tratadas con agua y jabón.

29. Really? What is he doing sa tapat ng room natin?

30. Matagal ko nang nararamdaman ang mga ito, kaya sana pwede ba kitang mahalin?

31. A lot of money was donated to the charity, making a significant impact.

32. Araw-araw, nagsasanay si Carlos Yulo ng ilang oras upang mahasa ang kanyang mga skills.

33. Sweet foods are often associated with desserts, such as cakes and pastries.

34. There's no place like home.

35. Les travailleurs peuvent être affectés à différents horaires de travail, comme le travail de nuit.

36. Mabuti na lamang ay sinunod nya ang alituntunin ng kanilang paaralan.

37. Sa tulong ng isang magandang pagsasalita at pang-unawa, ang tensiyon sa pagitan namin ay napawi.

38. Bago matulog, naglalaba ako ng aking uniporme para sa darating na school week.

39. Sa lahat ng paborito niyang prutas, ang saging ang may mababa na asukal.

40. Wala ka naman sa kabilang kwarto eh.

41. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

42. Ang kanyang determinasyon ay nagliliyab habang nilalabanan ang mga pagsubok sa buhay.

43. Ahhhh ok. Ilan ba ang kapatid mo? tanong ko.

44. Hindi maganda ang pagmamalabis sa trabaho dahil maaaring magdulot ito ng pagkaburnout.

45. Emphasis can be used to provide clarity and direction in writing.

46. Hindi nag-iingat ang bata kaya siya naaksidente sa kalsada.

47. Electric cars may have a higher upfront cost than gasoline-powered cars, but lower operating and maintenance costs can make up for it over time.

48. In 1905, Einstein published a series of papers that established the foundations of modern physics and earned him worldwide recognition.

49. Hinabol kami ng aso kanina.

50. Ang paglabas ng mga hayop mula sa koral ay binulabog ang katahimikan ng bukid.

Recent Searches

companiesfollowing,discipliner,saleslumiitnakakabangonmalayangmasasayakinatatalungkuangleksiyonkalakihoneymoonkasomagtakaikinamataypootnilolokoailmentsayokoamounttodaycalciumginoofranciscocaraballojuicekablanmakasilongkapwabinatilyoakongmagawahawaiinagbuntongincluirincreaseunconstitutionallunasenergibetweenituturodepartmentbinigyangisanabasateamcountriestotoonakatiranagmamaktolshoppingaddresscardigankuyatinatawagtinungoyourself,nohpag-aanikamijoynagdaraanautomatisereexpectationsbagamatpresence,makapangyarihangkalaunanpakakatandaannakamalayanakukuhaempresas1950smagkaibigankomedorbumigayturonnagpapasasaswimmingpagtinginnuonnakabibingingmagdoorbellluhakumalatpunong-punoritwalpampagandabuwayainspiretiniklingminahantignanpublicitytoymahaboloutlinespropesornag-aasikasopagkabatasalathulyohiningiadversebeforemaaringnapakamotpagtangisjolibeetumatawadpropensoferrernagdarasalnagpipikniksamakatwidnabuhayvelfungerendepulubihirampunsonagbakasyoninternaklasengbeerbwahahahahahalumayolumilingonquicklynavigationexplainbloggers,lasingcommunicaterawnagngingit-ngitsulyapaddpagkatmag-anakasanaiinisemphasismagazinespinalitanturismosalu-salomatagal-tagalbestkumampipinggandvdchessejecutaripipilitmanakboconocidosrelomagkasakitnapatakbohinihintaysakin1000nakipagskypeginagawahahanapinkailanmanngingisi-ngisingkatawannatabunanmukhamag-aaralmakakibodi-kawasathingsabalaautomationpatingsourceaninanunuriandrewmatigassalbahengkasalukuyanscientificpokerrenombrekagandahanbagongsinimulanthankpunongkahoyangelapinipilitsweetlaybraripatakbongalle