Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Las hierbas de té, como la manzanilla y la melisa, son excelentes para calmar los nervios.

2. Tumahol ang aso at natakot ang pusa.

3. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

4. Isang araw naglalakad si Ipong papuntang piging ng may bigla siyang nakasalubong na babaeng humihingi ng limos.

5. He plays chess with his friends.

6. Las hojas de palmera pueden ser muy grandes y pesadas.

7. ¡Muchas gracias por el regalo!

8. Ano?! Diet?! Pero tatlong plato na yan ah.

9. Inakalang wala nang pag-asa, pero may dumating na tulong.

10. I have seen that movie before.

11. Pinahiram ko ang aking costume sa aking kaklase para sa Halloween party.

12. Mahal ang mga bilihin sa Japan.

13. He is also relieved of the burden of needless expenses and ultimately becomes a happier and healthier citizen

14. Hindi ko inakala na magkakaroon ako ng ganitong pakiramdam, pero crush kita.

15. Alas-tres kinse na po ng hapon.

16. Television also plays an important role in politics

17. Napadungaw siya sa bintana upang tingnan ang magandang tanawin.

18. Ilang taon ka tumira sa Saudi Arabia?

19. Ang pakikinig sa mga paborito kong kanta ay isang nakagagamot na paraan upang maibsan ang aking mga problema.

20. Oo naman 'My! Walang hihigit pa sa Beauty ko noh.

21. Pagkaraa'y nakapikit at buka ang labing nag-angat siya ng mukha.

22. Pumasok ako sa cubicle. Gusto ko muna magisip.

23. Sumimangot ako at humarap ulit sa labas.

24. Don't beat around the bush with me. I know what you're trying to say.

25. Tara na. binuksan ko yung pinyuan tapos lumabas kami.

26. Ano ang pinakidala mo kay Sarita sa Maynila?

27. Hindi ako komportable sa mga taong nagpaplastikan dahil alam kong hindi nila ako tunay na kakampi.

28. Forgiveness can be a gradual process that involves acknowledging the pain, working through it, and eventually finding peace within ourselves.

29. Pahiram ng iyong payong, mukhang uulan na mamaya.

30. El cultivo de tomates requiere un suelo bien drenado y rico en nutrientes.

31. He sought to strengthen border security and pushed for the construction of a border wall between the United States and Mexico.

32. Dumating siya sa tindahan ng mga tuyong paninda at bumili ng isang kartong mantika.

33. Sa pag-aaral ng mga palaisipan, mahalagang maging mapanuri at malikhain upang malutas ang suliranin.

34. Pinilit nyang makipagtagisan sa abot ng kanyang makakaya.

35. Buwal ang lahat ng baldeng nalalabi sa pila.

36. Gracias por todo, cuídate mucho y nos vemos pronto.

37. Nationalism has been a driving force behind movements for independence and self-determination.

38. Foreclosed properties are homes that have been repossessed by the bank or lender due to the homeowner's inability to pay their mortgage.

39. Ang guro ko sa Ingles ay nagturo sa amin ng iba't ibang uri ng pangungusap.

40. Einstein also made significant contributions to the development of quantum mechanics, statistical mechanics, and cosmology.

41. Bihira na siyang ngumiti.

42. Puwede paki-ulit ang sinabi mo?

43. Ang utang ay nangangahulugan ng pagkakaroon ng obligasyon na magbayad ng isang halaga sa isang tiyak na panahon.

44. The store offers a variety of products to suit different needs and preferences.

45. Les archéologues utilisent la science pour comprendre les cultures du passé.

46. Amazon's Kindle e-reader is a popular device for reading e-books.

47. Sayang, tolong maafkan aku jika aku pernah salah. (Darling, please forgive me if I ever did wrong.)

48. Halos kassingulang niya si Ogor, ngunit higit na matipuno ang katawan nito.

49. Paparami iyon at pumapaligid sa kanya.

50. Ang pasya nang pagkapanalo ay sa tela ng matanda.

Recent Searches

following,kinikilalangnanlilisikhitsurajobsvirksomhedernamulaklakkapangyarihangnagandahanmamanhikanpagkasabimedikaltatayonagpabotunattendedpioneernovellesnagtataasnaglakadnabubuhaybusinessespagtutolpaanongnapatulalapagtatanimnakahugsumusulatadgangprimerossabihinlumuwasnareklamolandlinepawiinmananalomedicinealas-dosproducererlibertynalangkahongpaglulutonagtataeisinuotenglishmakauwitabingpoorertungkodescuelaseconomicbanalpinisilgumisingniyoconclusion,bumaliksaktandescargarmisyunerongcrameakmangincitamentermahalnagliliyabpag-isipananumanmerchandisequarantinekakayanankayobayangpayonghunihuertotatlongkumaenydelsergustongnakinigprocesoiyakforståphilippinedesarrollarfe-facebookpamamahingatamispinalayastomorrowmaghahandakinapelikulamagbigayannahigapamimilhingparurusahancompositoresenergiginawapeppyfatherteacherinalagaanheartbreakwifigoalmanuksonicokelanpasalamatandumaanmalumbayedsanakamadurasplasaniligawanfulfillingtoytanodlandopalaydangerouspaghingibestkongbasahinvelstandmalambingmansanascontent,gamotprimermagdaomelettefar-reachingupomassesbairdnakasuotkapetinderabilugangperlakwebangwidesumindisparkpumuntahamakfertilizercommissiontonmisusedtryghedsaannamwallettvsfriesnaritopyestadamitinisbarriersintroduce1973coaching:tomarrailfreelancerqualityneedsamamagbubungaprovidedcouldrolepartplaysnothingorderdollarwritedevelopablecertainworkshoplearningallowedstopelectedrobertquicklysystemhistorymahiwagangnakapamintanamaglalaro