Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Nasa unibersidad si Clara araw-araw.

2. Mahusay gumawa ng bahay ang kanyang tatay.

3. Sumakay ako ng taksi papuntang airport.

4. Ailments can be caused by various factors, such as genetics, environmental factors, lifestyle choices, and infections.

5. Kebahagiaan juga dapat ditemukan dalam pengembangan diri, seperti belajar hal baru atau mengejar hobi yang disukai.

6. Mahalagang maunawaan ang pangamba upang maipakita ang tamang pagkalinga sa ating kaligtasan.

7. Scissors are commonly used for cutting paper, fabric, and other materials.

8. Sang-ayon ako na importante ang pagpapahalaga sa ating kultura at tradisyon.

9. Nagliwanag ang buong paligid at naging abo ang katawan ni Matesa.

10. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

11. Hockey players wear special equipment such as helmets, pads, and gloves to protect themselves from injury.

12. He developed the theory of relativity, which revolutionized our understanding of space, time, and gravity.

13. Football is a popular sport for both men and women, with many professional women's leagues around the world.

14. Sa bundok ng mga anito na ngayon ay kilala bilang bundok ng Caraballo itinindig ang krus.

15. No te preocupes, estaré bien, cuídate mucho y disfruta de tus vacaciones.

16. Handa na bang gumala.

17. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

18. Samvittigheden er vores indre stemme, der fortæller os, hvad der er rigtigt og forkert.

19. Hindi ko alam kung kailan magiging tamang oras, pero sana pwede ba kita makilala?

20. Diversification is a strategy that involves spreading investments across multiple asset classes to reduce risk.

21. Baka makatatlo pa ang kanyang nanay ngayon!

22. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

23. Tendremos que tener paciencia hasta que llegue nuestro turno.

24. Dapat mong namnamin ang tagumpay na iyong pinaghirapan.

25. Parang tumigil ang lahat, sumabog na ang mga fireworks...

26. Matagal na kitang pinapanood at ngayon lang ako maglalabas ng katotohanan - may gusto ako sa iyo.

27. Don't count your chickens before they hatch

28. O sige na nga, diba magkababata kayo ni Lory?

29. Ang kanyang tula ay punong-puno ng panaghoy at pag-asa.

30. El atardecer en el mar es un momento sublime que muchos aprecian.

31. Anong ginawa nya sayo? Sya ba nagpaiyak sayo?

32. Nakasabit ang mga larawan ng mga nangungunang mag-aaral sa silid-aralan upang bigyan ng inspirasyon ang mga bata.

33. Pneumonia can be life-threatening if not treated promptly.

34. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

35. Kahit saan man ako magpunta, hindi ko makakalimutan ang aking kaulayaw.

36. I accidentally spilled the beans about the surprise trip, but she was still excited.

37. Supergirl, like Superman, has the ability to fly and possesses superhuman strength.

38. Nang muling lumusob ang higante, pinaulanan nila ito ng pana sa dibdib.

39. Naglalaway ako sa amoy ng niluluto mong adobo.

40. Sa mga malulubhang kaso, kailangan ng pagpapakonsulta sa espesyalista na dentista.

41. Nakabili na sila ng bagong bahay.

42. Tahimik ang buong bahay, waring walang tao sa loob.

43. I don't want to spill the beans about the new product until we have a proper announcement.

44. Con paciencia y perseverancia todo se logra.

45. Nag-usap kami kamakalawa ng tanghali.

46. Stop crying and pull yourself together, we have work to do.

47. The discovery of cheating can lead to a range of emotions, including anger, sadness, and betrayal.

48. Tila masaya siya, ngunit may lungkot sa kanyang mga mata.

49. Ang pagtitiyak ng seguridad sa mga border at mga pantalan ay mahalaga upang maiwasan ang pagpasok ng mga illegal na droga sa bansa.

50. Inihanda ang powerpoint presentation

Recent Searches

karununganfollowing,magagandangtumahimikpagtiisansasayawinmaihaharapkisshalu-halonakakainpioneerpangangatawanmahuhusaypagkasabikalalarotumutubonamumutlanag-iimbitainvestingpaglisantaglagaslaruinprimerossistemaspagamutannapapansinwatawathospitalattackflamencotonyvednakisakayiikutanbinge-watchingnabigyanvedvarendekapatagancriticsoverall1980lamesabernardopakaindollylittlenanoodsinisitaksiroofstockherramientasgatoltoymalumbaydisposalbilanggomatamanmatitigasenergiasomalambingkagandasupilinfamebansangtupelonag-aabangphilosopheretsynauliniganibiglawscompostelagisingmassestonightawaabeneprobablementebarrierscigarettesbaultrafficipagamotcoaching:showbalesaringipinikitsinabisorrynakapangasawatargetpalayanfaulttekstminutementalcanaffectrepresentativehulingtipabletechnologiesnotebookhapasinwaitbitbitpampagandaaudio-visuallymakidalopoliticsbeyondpanghihiyangescuelasfiakomedornakakulonglaki-lakitotoopagsuboknangampanyanakapuntapakanta-kantaenergynagdadasalatensyonnapansingulangdesisyonantahimikmagdamagangasolinakinalakihannami-missmagbibigaynakikitangpagkuwankerbmillionsbinabaantandamejohanloriadverselytherapynalagutanbinibiyayaanselebrasyonisasabadpagkaimpaktosimbahannanahimikpinapasayanagtatrabahosuelonasasakupanrevolucionadoobra-maestralumalangoymagkasintahanikinakagalitmagtatagalnakauwilalakiyumabongpinagbigyannanlalamigdoble-karapaki-drawingmedisinapakinabangantumalonmanilbihannai-dialmiyerkuleshanapbuhayuulaminmakawalapananglawhonestokainitandiferentespalamutinagbagojosienagbibirocualquierevolucionadonatinhinabipinakainpinisilkumantaestadospabilimakalingminervie