Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Different types of work require different skills, education, and training.

2. ¿Te gusta el sabor picante del jengibre?

3. The exhibit features a variety of artwork, from paintings to sculptures.

4. Sunud-sunod na nakatalungko ang mga ito sa isa pang bangkong nas atagiliran ng nanggigimalmal na mesang kainan.

5. Ibinigay niya ang kanyang tiwala sa akin upang mamuno sa proyekto.

6. Huwag mong hiramin ang aking payong dahil umuulan pa rin.

7. They play video games on weekends.

8. Biglang kumaripas ng takbo ang magnanakaw nang makita ang mga pulis.

9. Es importante mantener las heridas cubiertas y protegidas de la suciedad y los agentes irritantes.

10. May masakit ba sayo?? Ok ka lang ba?

11. Si Carlos Yulo ang naging inspirasyon sa pagbuhay muli ng gymnastics program sa Pilipinas.

12. El accidente produjo un gran tráfico en la carretera principal.

13. Kumukulo na ang aking sikmura.

14. Les enseignants peuvent organiser des projets de groupe pour encourager la collaboration et la créativité des élèves.

15. Sa paglutas ng mga palaisipan, mahalaga ang pagkakaroon ng positibong pananaw at pagpapakita ng determinasyon.

16. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

17. Ang mainit na tasa ng tsokolate ay animo'y nagbibigay init sa malamig na gabi.

18. My coworkers and I decided to pull an April Fool's prank on our boss by covering his office in post-it notes.

19. Emphasis can help clarify and reinforce the meaning of a message.

20. We sang "happy birthday" to my grandma and helped her blow out the candles.

21. Mukhang masarap ang prutas ngunit wala sino man ang mangahas na kumain nito sapagkat ang mga bunga ay lason.

22. Paborito nyang panoorin ang Baby shark sa youtube.

23. Puwede bang makausap si Maria?

24. All these years, I have been discovering who I am and who I want to be.

25. La mer Méditerranée est magnifique.

26. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

27. Mi sueño es ser un artista exitoso y reconocido. (My dream is to be a successful and recognized artist.)

28. Si Hidilyn Diaz ay nag-ensayo sa Malaysia bago sumabak sa Tokyo Olympics.

29. The business started to gain momentum after a successful marketing campaign.

30. Les algorithmes d'intelligence artificielle peuvent être utilisés pour prédire les tendances du marché et ajuster les stratégies commerciales en conséquence.

31. Einstein was a member of the NAACP and spoke out against racism in the United States.

32. Saan niya pinapagulong ang kamias?

33. Kebahagiaan adalah perjalanan pribadi yang unik bagi setiap individu, dan penting untuk menghormati dan mencari kebahagiaan yang paling sesuai dengan diri sendiri.

34. Palayo na nang palayo ang tunog ng kampana habang umuusad ang gabi.

35. Holy Week is a time of introspection and reflection, as Christians remember the sacrifice of Jesus and contemplate the meaning of his teachings and message.

36. Mapayapa ang kanilang lungsod sa pamumuno ng kanilang butihing Mayor.

37. The Constitution of the United States, adopted in 1787, outlines the structure and powers of the national government

38. People can also borrow money through loans, credit cards, and other forms of debt.

39. Ang pagkakaroon ng disiplina sa sarili ay mahalaga upang magkaroon ng maayos na pamumuhay, samakatuwid.

40. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

41. "Dogs come into our lives to teach us about love and loyalty."

42. Ang aking kabiyak ay ang aking katuwang sa buhay, nagbibigay ng tulong at suporta sa bawat yugto ng aming paglalakbay.

43. Nagulat siya ng makita niya ang isang usa na malapit ng kainin ng isang tigre.

44. Sa pagpapabuti ng bansa, dapat isipin ang kinabukasan ng mga susunod na henerasyon.

45. Ang mga bayani ay nagpapakita ng disiplina at determinasyon sa paglutas ng mga problema ng bayan.

46. Sa aking hardin, ako ay nagtatanim ng mga bulaklak.

47. "Maghintay ka lang," ani ng guro sa kanyang estudyante.

48. Magaling maglaro ng chess si Joseph.

49. Put all your eggs in one basket

50. Sa panghihiyang ginawa ni Kablan, gumanti ang pobreng matanda.

Recent Searches

following,taga-nayonkanserbabasahininalalayanadditionallylumikhaexpresannerissacriticstrestilgangriyancassandradiagnosticinjurynakalilipasmusicianisinalaysaydiningmetrokassingulangnaglakadpaglayastanghalikundikindergartenzoomagbabagsikkabarkadacallairplanesinterpretingcarmenprotegidokalayuanferrerproducirelenaginangwouldsenateimposiblebehaviorforståconectanauthornapapatinginnuclearmatafederalmonitorsettingonlyissuesluto1876allowedinaabutanpyschepapelbroadcastpag-alagaabsgamitiniintayinjoshrhythmgrowtharghmanatilitargetnagdaboglibertykalakingmaihaharaptinawanankaliwangipinalitnakapilaflamencoaeroplanes-allmanuksohardresumenmovingcapacidadellaimeldacurrentmarmaingtinatawagkainankaagadintensidadnalugodkapangyarihansagingmacadamiakinapanayamracialtravelpinakamatapatnangampanyahinagisitimmaraminagbakasyonlangithumalakhaknagbibigayanhistoriagobernadorbasacoachingmagbayadlitokasalukuyansukatpalamutilaki-lakiinformednakakaanimnakaakyatisipaniniuwileukemiapakakasalanpabulongalas-diyesopisinalumabaskinikilalangworkshopmanirahannagandahancreditnakakatabatahananevolucionadoatensyongmagpapigilcompositoreslumayofertilizerkinalilibinganlettereksperimenteringbukodibinubulongnakikianatalopnilithalakhakhojasdelegumawahanggangwinsrabepinaulananamericasponsorships,instrumentalwifinabasainlovegarbansosparaangibabawpatawarintig-bebeintecantidadkumantaisusuotnaiiritangsinipangmbricostsonggobinatilyogulangmamarilindependentlysnobarabianatitiranovemberlaamangamplialittletheirnahulogguhitdisciplindrawingbumiligotritwal1954chad