Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. The stock market can be influenced by global events and news that impact multiple sectors and industries.

2. Nakatanggap ako ng email sa dakong huli ng gabi mula sa aking boss.

3. Los powerbanks se han convertido en un accesorio imprescindible para muchas personas que dependen de sus dispositivos electrónicos.

4. Bumili si Ana ng regalo para diyan.

5. Membuka tabir untuk umum.

6. Marami kaming handa noong noche buena.

7. Hindi dapat tayo magpaplastikan dahil mas makakabuti kung magiging totoo tayo sa isa't isa.

8.

9. Nareklamo ko na ho ito pero wala hong sagot.

10. Si Tom ay masipag sa trabaho, datapwat hindi marunong mag-ayos ng kanyang mga gamit.

11. Napangiti na lang ang binata at sumama sa dalaga, simula ng araw na iyon ay lagi na silang nagkikita.

12. Dalawang libong piso ang palda.

13. Gracias por escucharme cuando más lo necesitaba.

14. Lahat ay nakatingin sa kanya.

15. Ang paglabas ng impormasyon tungkol sa isang malaking skandalo ay binulabog ang buong bansa.

16. Fødslen markerer en begyndelse på et nyt kapitel i livet som forældre og en påmindelse om, at livet er en konstant cyklus af transformation og fornyelse.

17. Naglalaro ang walong bata sa kalye.

18. Foreclosed properties can be a good option for those who are willing to put in the time and effort to find the right property.

19. Panahon na lang ang hahatol kung nararapat na ngang ibalik sa dating anyo si Kiko.

20. Don't count your chickens before they hatch

21. This can include reading other books on the same topic, interviewing experts, or gathering data

22. Wala na naman kami internet!

23. Magkano ito?

24. My favorite thing about birthdays is blowing out the candles.

25. Ako naman, poker face lang. Hahaha!

26. Les hôpitaux sont équipés pour fournir des soins d'urgence aux patients.

27. Pinilit nyang makipagtagisan sa abot ng kanyang makakaya.

28. Nang tayo'y pinagtagpo.

29. Ang magnanakaw ay nasakmal ng aso ng may-ari habang tinutukan siya ng baril.

30. The intensity of baby fever can vary from person to person, with some feeling a passing longing and others experiencing a persistent and overwhelming desire.

31. Ang magsasaka ay nagtatanim ng palay sa bukid.

32. Mahal na mahal ng ama't ina si Ranay.

33. Ang nagtutulungan, nagtatagumpay.

34. The culprit behind the product recall was found to be a manufacturing defect.

35. Kailangan nating magtiyaga at magsumikap sa ating mga pangarap, datapapwat ay hindi ito agad-agad natutupad.

36. The website's contact page has a form that users can fill out to get in touch with the team.

37. Mi amigo es muy bueno con las palabras y siempre me ayuda con mis discursos.

38. Lazada has faced criticism over counterfeit products being sold on its platform.

39. Si Ranay ay isang matakaw na batang nakatira sa mahirap na bayan ng Sto. Domingo.

40. Las escuelas públicas son financiadas por el estado y son gratuitas para los estudiantes.

41. Les maladies infectieuses telles que le VIH/SIDA, la tuberculose et la grippe peuvent être prévenues grâce à une bonne hygiène et des vaccinations.

42. Los recién nacidos son pequeños y frágiles, pero llenan nuestros corazones de amor.

43. Ipinagbibili ko na ang aking kotse.

44. The Great Barrier Reef in Australia is a wonder of marine life and coral formations.

45. Las hojas de palma se usan a menudo para hacer sombreros y cestas.

46. Ang mga akda ni Rizal tulad ng "Noli Me Tangere" at "El Filibusterismo" ay naglalaman ng mga kritisismo sa pamamahala ng Espanya at nag-udyok sa rebolusyonaryong diwa sa Pilipinas.

47. Sa paglipat niya sa ibang bansa, kinailangan niyang mag-iwan ng mga kaibigan at pamilya.

48. Natutuwa ako sa pag-aalaga ng mga halaman kaya nahuhumaling ako sa pagtatanim.

49. Nangyari ang isang insidente na nagdulot ng takot sa kanya, kaya't nais niyang maglimot na lang tungkol sa pangyayaring iyon.

50. Libreng nakakakuha ng atensyong medikal ang lugar nila Alfred.

Recent Searches

following,lumiwagnagsagawanapakahusayhubad-baronakakasamasinakamiasarbularyonagdabogtv-showsmagsusuotkayabanganpamasahenaantigngunitpare-parehonapansinkagubatanumiibigtinungoumiisodtinataluntonkamandagpinyaseeritowalngpangingimiamparoeuphoriclapitanempresasmagselospapuntangtherapeuticssilid-aralankaliwabangkangsalarinriegamassachusettsunconstitutionalsampungpantalongisinaraika-50direksyonpinaghagdanpalakamaisipmaonghabitmatayogpalibhasatagakcompletamentenanoodmatangkadnababalotcaraballobihasanagitlaaminuntimelysarakasaysayancarboncarriespangkatlalakedumilatku-kwentalungkotsilacryptocurrency:pakelambilinbalingulamplacehearbarnesschoolshumanoatinwatchingzoomsubjectcardnuonhomeworkchangesumalaipinikitkitangadverselyconvertidaspersonalbadrestipinagbilingcomunesdontakecommunicationdayandycountlesselectedlibagpuntaipagtimplawhylayunindependingworkcontrolaipinalutoeithertermclassmatecreatingnanlalambotnagpagupitslavekingdombakitengkantadainangtunayperpektingkapwanagmasid-masidsiguradocomputere,growthsenatekontratahunisaktannagsamajeetalagangpinagkakaabalahaniniisipbosesnakaka-bwisitestateiigibprincearoundsamfundbahay-bahayangrankinasisindakanmedya-agwapagkaraaipinansasahogmariokarnabalenforcingcuentanbobobangladeshhitsuraproductsngumingisimananakawsunud-sunodkapangyarihangpanindangbayaninginiindabunutaninventiongardenmatacoaleducationpaki-basamanuksobasahancupidutak-biyaservicesrelievedincludeinspiredsteamshipsxviimakisuyokamalianumiwaspadalasnaiinistamarawgarbansostradisyon