Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. The politician tried to keep their running mate a secret, but someone in their campaign let the cat out of the bag to the press.

2. We have been painting the room for hours.

3. Les robots dotés d'intelligence artificielle peuvent effectuer des tâches répétitives et dangereuses pour les humains.

4. Mabilis na lumipad ang paniki palabas ng kweba.

5. Nagandahan ako sa simula ng konsiyerto.

6. Ang pagbasa ng mga positibong pananaw at inspirasyonal na mga salita ay nagdudulot sa akin ng isang matiwasay na pananaw sa buhay.

7. Minsan, masarap din namang kumain ng nag-iisa para mapag-isipan ang mga bagay-bagay.

8. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

9. The football field is divided into two halves, with each team playing offense and defense alternately.

10. Ese comportamiento está llamando la atención.

11. Marahil ay hindi ka na magkakaroon ng pagkakataon na gawin ang bagay na ito.

12. Ang haba ng prusisyon.

13. Masarap maligo sa swimming pool.

14. Parang kaming nageespadahan dito gamit ang walis at dustpan.

15. Hindi rin niya inaabutan ang dalaga sa palasyo sa tuwing dadalawin niya ito.

16. The restaurant bill came out to a hefty sum.

17. Hindi ko alam kung pano ito sasabihin, hindi na ako magpapaligoyligoy pa, si Helena ay wala na.

18. Ako ay nagtatanim ng mga succulent plants sa aking munting terrarium.

19. Ibinigay ko ang aking payo at opinyon upang makatulong sa pagresolba ng problema.

20.

21. Napakabagal ng proseso ng pagbabayad ng buwis, animoy lakad pagong.

22. Mahilig siya sa pag-aaral ng mga klasikong akda ng panitikan, at ang pag-aaral na ito ay nagbibigay ng karagdagang kulay sa kanyang karanasan.

23. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

24. The chef created a series of dishes, showcasing different flavors and textures.

25. Ang pusa ay naglaro ng bola ng sinulid buong maghapon.

26. Oscilloscopes can be portable handheld devices or benchtop instruments with larger displays and advanced features.

27. Después del nacimiento, la madre necesitará tiempo para recuperarse y descansar, mientras que el bebé necesitará atención constante y cuidado.

28. Efter fødslen skal både mor og baby have grundig lægeundersøgelse for at sikre deres sundhed.

29. Ayoko magtrabaho sa bahay sapagkat naiinis ako sa buhok na ito.

30. Paborito ko kasi ang mga iyon.

31. May lagnat, sipon at ubo si Maria.

32. Make sure to keep track of your sources so that you can properly cite them in your book

33. The cough syrup helped to alleviate the symptoms of pneumonia.

34. Amazon is an American multinational technology company.

35. They launched the project despite knowing how risky it was due to time constraints.

36. Hinikayat ang mga turista na lumibot sa mga nakakaakit na tanawin ng naturang isla.

37. Børns leg og kreativitet er en vigtig del af deres udvikling.

38. Nagreport sa klase ang mga grupo nang limahan.

39. The invention of the telephone led to the creation of the first radio dramas and comedies

40. The acquired assets were key to the company's diversification strategy.

41. Puwede akong tumulong kay Mario.

42. You reap what you sow.

43. Nag merienda kana ba?

44. Format your book: Once your book is finalized, it's time to format it for publication

45. Presidential elections are held in November and involve a system of electoral votes, where each state is allotted a certain number of votes based on population

46. Sa hirap ng buhay, ang aking kabiyak ay ang aking kakampi at kasama sa pagtahak ng mga hamon.

47. Sa takip-silim, nagiging malamig ang panahon at nakakapagbigay ng komporta sa mga tao.

48. Sa kabila ng mga hamon, ipinakita ni Hidilyn Diaz na walang imposible kung may tiyaga.

49. James Buchanan, the fifteenth president of the United States, served from 1857 to 1861 and was in office during the secession of several southern states.

50. Parehas na galing sa angkan ng mga mahuhusay humabi ang mag-asawa.

Recent Searches

gulatfollowing,nagsagawakarununganmagsusunuranmanggagalingmaglalaronagandahankinikilalangnagtatanongadecuadoitimmaramimababawkinamagsalitanakakitamagbagong-anyopinakamahalagangkumembut-kembotentergumagalaw-galawmegetmakitanapakahusaypagkamanghasaranggolanapakatalinomanamis-namispodcasts,nagagandahannakapangasawabiologigratificante,ninyoarmaelmagsusuotmagpalagopagkasabilalakifitnesssunud-sunurannapagtantounattendedpilapagsisisinakatapatmakasilongteknologinaglaromasyadongmagtakaadgangkongresopaghahabimagbalikpagbabayadpagtatanimpagkuwanhululumakinapapahintomedikalfranciscoalas-doshinahanaphinihintaynakilalamaasahanmiyerkulesmagdamagmagagamitinuulamisinuotumiisodtungkodtabingalingumaganginloveproducerertinuturotradisyonlumagolansangankastilangisinaboynabuhayibinigaykaliwapalamuticardiganregulering,kahoypanahonnag-eehersisyoexigentedesign,naglulusakpabilikirbyrewardingkuligligpaaralanoperativosbilihinpinabulaanmagsabigarbansoskapataganpangakocandidatesmatangumpayjolibeeengkantadamalawakpesosninyongtransportniyanbasketballendvidereestadosmanalomatamansalestalagajobdustpannahulaanhabitshoppingsirapinilitbayangabutansayawesternsalitakasaysayantuvopossiblerisetoynenacubiclepangkatproducts:lalakemissionmataasthroatyorknararapatsignvelstandmeanstupelofilmsbutchbalanglinawvistrenatocarbonpuliswastepanindanginiwanteleviewingpangingimiyeptaasipapaputolvalleytinderaiilanasohdtvaabotpepenagdarasalpersonalbilinbarnesbatoburgerplacewestprimeranimoykadaratingitongcompostelatakesrailways1876utusanresearchhall