Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Manahimik ka na nga, tara ng umuwi! Andyan na driver ko!

2. Mahilig akong makinig ng music kaya laging nahuhumaling sa mga bagong kanta.

3. She helps her mother in the kitchen.

4. Uno de los festivales de música más importantes de España es el Festival de San Sebastián, que se celebra en septiembre y cuenta con la participación de artistas de renombre internacional

5. She decorated the cake with colorful sprinkles and frosting.

6. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

7. Tulala siya sa kanyang kwarto nang hindi na umalis ng buong araw.

8. The depth of grief felt after losing a loved one is immeasurable.

9. Gusto ko hong magpapalit ng dolyar.

10. Wag mo na akong hanapin.

11. I don't think we've met before. May I know your name?

12. Boboto ka ba sa darating na eleksyon?

13. Malapit ang pook na ito sa bundok ng Rabba.

14. Saan siya nagpa-photocopy ng report?

15. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

16. Sa panahon ng digmaan, madalas na nangyayari ang mga krimen laban sa karapatang pantao.

17. Natatanaw na niya ngayon ang gripo.

18. The Incredible Hulk is a scientist who transforms into a raging green monster when he gets angry.

19. She is studying for her exam.

20. Scientific inquiry is essential to our understanding of the natural world and the laws that govern it.

21. Many charitable institutions rely on volunteers to sustain their programs.

22. Ang buhay at mga akda ni Rizal ay patuloy na pinag-aaralan at pinag-aaralan ng mga estudyante at mga historyador sa buong mundo.

23. Magkasamang tutungo sa lugar na walang sakit, walang gutom, walang hirap.

24. Inakalang masama ang panahon, pero biglang sumikat ang araw.

25. Ketika menghadapi tantangan hidup, penting untuk menjaga keseimbangan antara kerja keras dan istirahat yang cukup.

26. Diretso lang, tapos kaliwa.

27. Niluto nina Tony ang isda sa kusina.

28. Emma Stone won an Academy Award for her role in the film "La La Land" and has appeared in movies like "The Help" and "Easy A."

29. Sebagai tanda rasa terima kasih, orang tua bayi akan memberikan hadiah atau makanan khas kepada para tamu yang hadir.

30. Las hojas de mi cuaderno están llenas de garabatos y notas.

31. People who give unsolicited advice are a dime a dozen.

32. Jeg tror, jeg er ved at blive forelsket i ham. (I think I'm starting to fall in love with him.)

33. La santé des femmes est souvent différente de celle des hommes et nécessite une attention particulière.

34. Matapos ang pangunahing pangyayari sa kabanata, nagkaroon ng bagong direksyon ang kuwento patungo sa susunod na yugto.

35. Las pinceladas sueltas y rápidas le dan a la pintura un aspecto más dinámico.

36. Nakapagsasakay ang dyipni ng 16 na pasahero.

37. Ano ang pinakidala mo kay Sarita sa Maynila?

38. Hindi pa ako naliligo.

39. OMG. Makalaglag-panty si Kuya!!

40. Oh bakit nandito ka pa? ani Maico bilang tugon.

41. Natutuwa siya sa husay ng kanyang naisip.

42. He missed his flight and then his luggage got lost. That just added insult to injury.

43. Danmark er kendt for at eksportere højteknologiske produkter og services til andre lande.

44. Hindi dapat natin husgahan agad ang mga taong bukas palad sa kanilang buhay dahil baka sila pa ang tunay na maligaya.

45. Videnskab er systematisk undersøgelse af natur og universet ved hjælp af metoder som observation, eksperimentering og analyse

46. Ano pa ho ang dapat kong gawin?

47. Madami ka makikita sa youtube.

48. For you never shut your eye

49. Ano ang gagawin mo sa Linggo?

50. Bukas ay magpapagupit na ako ng buhok.

Recent Searches

following,nasaanprincipalespaglulutofactoreshatinggabiproporcionarproducerersocialespropesornatatawadealduwendeumulankumainfrescoeclipxeimagestoyisinaraipinakitaadangnapasukomauntogbayaningkatagangmarchpakpakvideopusanegosyosapilitangthroatnakatirailalagayenergicultivanamaheartbreaknatulogtag-ulandyipareastinitirhankumukuloblusamalusogkadaratingtuwanghehegrammarlearnwouldfeedbackpilipinaselectedstudentkoneknginingisihaneachmakapanglamangnaiiritangdamingnuonpangalantumapospintuanasiainstrumentalnilulonawabagotutorialsabalaactualidadmoneysinampalplagasmakaratingpaghuhugaskumaenpang-araw-arawvegasdiapersabinakahigangbanlagaktibistadiwataestábukasbeautykassingulanghirambabaetryghedscalepinakidalanapakalakingpalaisipannagtakababasahinpalancatitigilpagkatipanghampasgirlfriendgymipagmalaakitamadkwebamrsbigaspakidalhaniconicmangingisdapaga-alalakinauupuangbahay-bahaynagtungomakakasahodpinagsasasabitinulak-tulakhumahanganagtatakanghouseholdsmakalawabiologipinabayaankumikinigtatawagteknolohiyaprocessinsektonalugmoktatanghaliinkinabukasannag-uumigtingpag-aaraldescargarkamaokindergartenkalaronakamitibahagisapatosnakitulogmahiligmaghaponkuwentonagbentaipaghandasinunggabanbayabaspapasokumikotpinasokkamalayanhiyatiboksumasagotkutsaritangminabutilungkotmagtanimmahababahagicnicotibigproudindividualslahatstoplasakelanaffiliatepusangkumatokpigingpedroawayoverallmodernnahulimangpitonakapagsabidecreaseexamplekapilingprojectshelloeditsittingdelthengiftanimomaputulanjerry