Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Hala, change partner na. Ang bilis naman.

2. Kahit na lilipad ang isip ko'y torete sa'yo.

3. Den danske økonomi er bygget på en kombination af markedsekonomi og offentlig regulering

4. Napapikit ako at naglabas ng malalim na himutok upang maibsan ang aking pagod.

5. Medarbejdere kan opnå ekstra fordele som bonusser eller tillæg for deres fremragende arbejde.

6. Kinuha ko yung CP ko at nai-dial ang number ni Joy.

7. Pakanta-kanta si Maria habang nagtatrabaho.

8. Les personnes âgées peuvent avoir des difficultés à mémoriser et à apprendre de nouvelles informations.

9. Kung hindi naman ninyo kaya ay sabihin ninyo at tatawag ako ng ibang pulis.

10. I am not working on a project for work currently.

11. Nauntog si Jerome sa kanilang pintuan.

12. I forgot my phone at home and then it started raining. That just added insult to injury.

13. Aanhin ko 'to?! naiiritang tanong ko.

14. En invierno, muchas personas disfrutan de deportes como el esquí y el snowboard.

15. Commuters are advised to check the traffic update before leaving their homes.

16. May tatlong kuwarto ang bahay namin.

17. Nagpunta sa kumbento si Sister Jane.

18.

19. My sister gave me a thoughtful birthday card.

20. Nagkatinginan ang mag-ama.

21. LeBron James is a dominant force in the NBA and has won multiple championships.

22. Sino-sino ang mga pumunta sa party mo?

23. Ada juga tradisi memotong tali pusar setelah kelahiran, yang dianggap sebagai tindakan penting untuk menjaga kesehatan bayi.

24. Sa bawat pagkakataon, dapat nating ipaglaban at ipagtagumpay ang ating kalayaan.

25. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

26. The charity organized a series of fundraising events, raising money for a good cause.

27. The Pyramids of Chichen Itza in Mexico are an impressive wonder of Mayan civilization.

28. Kailangan ko ng Internet connection.

29. No tengo palabras para expresar cuánto te agradezco.

30. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

31. Madali ka nitong bibigyan ng paninda kung may sarili kang bangkang paghahanguan ng mga huling isda sa karagatan.

32. The patient was advised to limit alcohol consumption, which can increase blood pressure and contribute to other health problems.

33. I am absolutely grateful for all the support I received.

34. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha revolucionado la forma en que las personas se comunican

35. Aplica abono orgánico al suelo para proporcionar nutrientes adicionales a las plantas

36. Gado-gado adalah salad sayuran yang dicampur dengan bumbu kacang yang kaya rasa.

37. Makisuyo po!

38. Kasama ang aking kabiyak, nalalampasan namin ang mga pagsubok at hamon na dumadaan sa amin.

39. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

40. Walang anak sina Mang Kandoy kaya't ganoon na lamang ang dasal nila sa Panginoon upang mabigyan sila ng anak.

41. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

42. He appointed three Supreme Court justices during his presidency, shaping the ideological balance of the court.

43. Magandang umaga po. ani Maico.

44. Nag-aral ako sa library kaninang hapon.

45. Sa kabila ng pag-usbong ng modernong medisina, nananatili pa rin ang tiwala ng marami sa albularyo.

46. Sinubukan kong gumawa ng kakanin gamit ang pulotgata, ngunit hindi ko nagustuhan ang lasa.

47. Pede bang itanong kung anong oras na?

48. They are not building a sandcastle on the beach this summer.

49. Da Vinci fue un pintor, escultor, arquitecto e inventor muy famoso.

50. Kuwartong pandalawahan, hindi ho ba?

Recent Searches

following,pagkasabilumuwaspamumunoblessnaiwanlayuninpinangyarihanenviarnawalakilalaampliatraditionaltsssambagprofoundmagitingenergitoyphilippinehalikajoenobleuntimelyasthmapag-aralingrinsbroadcastboyetsumaliclockelectedpracticeswealtheasylandasinternetkagabinaglulusaktinikmansuriinsubject,kabighasaktannaliligona-suwayhahatolinirapanisulatnagkapilatbiologimiyerkolespag-itimnagpakitakumembut-kembotkwenta-kwentat-shirtnagmungkahimagnakawnagpapasasabagoguitarraumiinompinakidalanalakimahuhusaypakikipagbabagmagagawautak-biyanagbabalamarteskahongmarasiganbwahahahahahanakataasmakakabalikvillagesundalotangekssiyudadhinanakitcover,nakabluenagsilapitnaghilamostennistinataluntonpangako3hrssakopmatulunginasahansumasakayundeniableantesnalamanhigpitanmatangedadnatagalankaninumangjortnilalangcasheleksyonmarielganyantilikakayanankasamalalonglazadabiyasphilosophicalsayawanilagaysurroundingsbumigaykarapatanfulfillingbulaklilyrisenyantamishmmmmsigemininimizesigatiniokinainmembersdogsanimoyanothervocalmesangmadamimedievalpitokaarawanilanghidingmakaratingkasaysayanbipolarbumababachadsumindicallerbaulfaketenderexpertagosconventionalhallitinalisaringnamingbarrierspagsasalitadollarspeechagepreviouslykiloputitabiaddressremotetoolryannamungareleasedbeinginteriorpag-iinatspecialupoexpectationsmakapilingdoingsequeevolvesalapiflashduloattorneymakakatakaspag-aaralassociationpag-iyaknuevopioneermapadalimabutikatolisismonapadpadginawang