Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Los powerbanks también pueden tener características adicionales, como indicadores LED que muestran el nivel de carga.

2. Les travailleurs peuvent travailler de manière saisonnière, comme les agriculteurs.

3. Kailangang salatin mo ang tela para malaman kung gaano ito kalambot.

4. Bakit ba nagkaroon ng landslide at baha?

5. Galit ng galit ang ama ni Bereti nang may nakapagsabi na namumulot at kumakain ng tirang pagkain ang anak.

6. Ang pagkakaroon ng malalakas na ingay mula sa kapitbahay ay binulabog ang kapayapaan ng tahanan.

7. Promise babayaran kita in the future. sabi ko sa kanya.

8. A couple of friends are planning to go to the beach this weekend.

9. Limitations can be a result of geographic location or access to resources and opportunities.

10. Ok ka na ba? tumango si Athena, Mabuti naman..

11. Napatingin ako sa kanya bigla, Kenji?

12. S-sorry. mahinang sabi ni Mica.

13. Sa aming pagtitipon, nagkaroon ng palaro at paligsahan na nagpapakita ng diwa ng bayanihan.

14. Muchas personas pobres no tienen acceso a servicios básicos como la educación y la atención médica.

15. Nag-email na ako sayo kanina.

16. Mayroong dalawang libro ang estudyante.

17. Oscilloscopes can be connected to a computer or network for data logging, remote control, and analysis.

18. He was known for his active and controversial presence on social media, particularly Twitter.

19. Les chimistes travaillent sur la composition et la structure de la matière.

20. Elektronisk udstyr kan hjælpe med at forbedre effektiviteten og produktiviteten af ​​virksomheder.

21. Inihanda ang powerpoint presentation

22. May sakit pala sya sa puso.

23. Gusto mong makatipid? Kung gayon, iwasan mong gumastos sa mga di-kailangang bagay.

24. The victim's testimony helped to identify the culprit in the assault case.

25. Hinde ko dala yung cellphone ni Kenji eh.

26. Hindi mo na kailangan ang magtago't mahiya.

27. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

28. The seminar might be free, but there's no such thing as a free lunch - they'll probably try to sell you something at the end.

29. Ang mga firefighter nagsisilbi upang protektahan ang mga tao mula sa mga sunog.

30. Ang kahirapan at kawalan ng trabaho ay kadalasang problema ng mga anak-pawis.

31. Napadungaw siya sa bintana upang tingnan ang magandang tanawin.

32. Sa probinsya, maraming tao ang naglalaba sa ilog o sa bukal.

33. Le musée d'Orsay est un incontournable pour les amateurs d'art.

34. Bumili kami ng isang piling ng saging.

35. Nagtitinda ang tindera ng prutas.

36. La science de l'informatique est en constante évolution avec de nouvelles innovations et technologies.

37. Paliparin ang kamalayan.

38. Los Angeles has a vast and efficient public transportation system, including buses, trains, and a subway network.

39. Bukas ay mamamanhikan na kami sa inyo.

40. All these years, I have been learning to appreciate the present moment and not take life for granted.

41. Kawah Ijen di Jawa Timur adalah tempat wisata populer untuk melihat api biru yang terlihat di dalam kawah gunung berapi.

42. Sa matinding sikat ng araw, tila sya ang mandirigmang sugatan, ngunit matatag na nakatindig sa pinagwagihang larangan.

43. Siya ay nagiigib ng tubig sa banyo habang nag-aayos para sa trabaho.

44. I am not planning my vacation currently.

45. Bata pa lamang ay kinakitaan ng ito ng husay sa larong chess.

46. La paciencia nos enseña a esperar el momento adecuado.

47. Siya ang nagpatuloy sa pag-aagwador.

48. The traffic on social media posts spiked after the news went viral.

49. Waring malungkot siya ngayon, ngunit hindi niya sinasabi kung bakit.

50. Walang mangyayari satin kung hindi tayo kikilos.

Recent Searches

following,bloggers,pamilyangluluwasawtoritadongmasasayaricaguitarranakakamitmontrealpakakatandaannangangalitambisyosangpagkasabiphilanthropygandahannanlalamigmagagawakabuntisanmakasilongisasabadmagtakamakawalavideossinusuklalyankinalalagyanmagpahabadesisyonannaglokoumuwishowscompaniesika-12nanonoodtuktoknatatawamagamotkommunikerermarketingmanilbihantingingtherapeuticssamantalanglumusobnabiawangseryosongtulisanbakantekumanantelebisyontiniklingmadadalapiyanopumikitmakisuyoskillskalabankargahansocialeskaninanangyariwaringmaligayanagplaysiguroteachingsumulanriegaitinaasbenefitssunud-sunodumagakamotecashitinulosadmiredmauntogmalawakdealaustraliabusiness:sumpainmaalwangyoutubelihimkambingpersonmagsaingmerchandiseshoppingilankalakingkahilinganbinasatoykuyahundredenerginamakalongwifireviewwikathroatfriendhoyfiverrtulalacareergatheringfreeubodarbejdertradekatandaansigenoblebilaomanualboyetdisappointfireworkspakelammegetlawsbossclientsipinadalaencountercoinbasecomeideyafeellabingglobalfraresponsibleferrerreportpublishinghelpfulmeandumatingspasarilingrawregularmentemarkedstatetalestylesinspiredschooltutorialsactordifferentryanbetaelectedfeedbackpaglisanmabatongvidenskabentibokpagsidlanpinanawannodbalangnapakagandangkalalakihanbiglafallhangaringtatawaganpabalangbumababalalabhandrayberprutasmeetcallermedievalbobobroadcastpakainomeletteasimfiapinatidmagkakaroonpalaisipancancernakatalungkopagtutolnegro-slavesmakapalaginvestingfotosuntimelynahiga