Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. May mga kultura na gumagamit ng mga tradisyunal na hudyat sa mga seremonya o ritwal upang iparating ang mga espesyal na kahulugan.

2. The Little Mermaid falls in love with a prince and makes a deal with a sea witch to become human.

3. Reinforcement learning is a type of AI algorithm that learns through trial and error and receives feedback based on its actions.

4. Ipinahamak sya ng kanyang kaibigan.

5. We need to reassess the value of our acquired assets.

6. Salah satu bentuk doa yang populer di Indonesia adalah sholat, yang merupakan salah satu rukun Islam.

7. Nationalism can be a source of inspiration for artists, writers, and musicians.

8. The United States is a federal republic, meaning that power is divided between the national government and the individual states

9. The team lost their momentum after a player got injured.

10. ¡Feliz aniversario!

11. Kahit hindi siya lumingon, para na niyang nakita si Ogor.

12. Si Juan ay nagiigib ng tubig mula sa poso para sa mga halaman sa hardin.

13. Tse! Anong pakialam nyo? Bakit maibibigay ba ninyo ang naibibigay sa akin ni Don Segundo? sagot ni Aya.

14. Sa mula't mula pa'y itinuring na siya nitong kaaway.

15. Stress can be a contributing factor to high blood pressure and should be managed effectively.

16. They have been renovating their house for months.

17. Hindi sang ayon si Magda sa mga sinabi ni Mariel.

18. Muchas personas disfrutan tocando instrumentos musicales como hobby.

19. Madali naman siyang natuto.

20. Matagal na napako ang kanyang tingin kay Kano, ang sumunod sa kanya.

21. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

22. Ang bansa ay dapat lagi nating isipin, hindi lamang ang ating sariling interes.

23. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

24. Amazon's headquarters are located in Seattle, Washington, but it has offices and facilities worldwide.

25. Ang amoy ng sariwang ligo ay nagbibigay ng mabangong pakiramdam sa buong araw.

26. Ang saranggola ni Pedro ay mas mataas kaysa sa iba.

27. Ugali mo panget! Bitawan mo nga ako! Sisipain na kita!

28. La science des données est de plus en plus importante pour l'analyse et la compréhension de grandes quantités d'informations.

29. Sa computer nya ginawa ang disensyo ng kanyang invitation.

30. Alors que certaines personnes peuvent gagner de l'argent en jouant, c'est un investissement risqué et ne peut pas être considéré comme une source de revenu fiable.

31. Nagdiriwang sila ng araw ng kalayaan.

32. Ang parusang angkop sa suwail na anak ay iginawad.

33. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

34. Pinaplano ko na ang aking mga gagawing sorpresa para sa aking nililigawan sa darating na Valentine's Day.

35. Sa gitna ng mga problema sa trabaho, hindi maiwasang ikalungkot niya ang kakulangan ng suporta mula sa kanyang boss.

36. La paciencia es necesaria para alcanzar nuestros sueños.

37. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

38. Nagsmile siya, Uuwi ka ha.. uuwi ka sa akin..

39. Tumango lang ako. Wala ako sa mood na magsalita.

40. Hendes historie er virkelig fascinerende. (Her story is really fascinating.)

41. Ang pangamba ay maaaring maging dahilan ng pagkakaroon ng insomnia o hindi makatulog sa gabi.

42. Nagliliyab ang puso ni Andres sa pagmamahal para sa kanyang pamilya.

43. Malaya na ang ibon sa hawla.

44. Football is played with two teams of 11 players each, including one goalkeeper.

45. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

46. The player who has the ball is called the "offensive player," and the player guarding him is called the "defensive player."

47. Eating a balanced diet can increase energy levels and improve mood.

48. Es un placer conocerte, ¿Cómo te llamas?

49. Bagaimana pendapatmu tentang film yang baru saja tayang? (What is your opinion on the latest movie?)

50. Hindi. Ipinangangak ako sa Cebu.

Recent Searches

following,pagkasabimagdaankusinerotravelproducerersugatangpansamantalakinaminahanroofstockskillssisidlanhanginbuhokbinibilienergitrajepublicationtinitindagrammarcassandrabumabagtoymabutinglaylayteachspendingsamubinabalikgraphicmabiliselectedalinredsingernag-umpisabituinberkeleykayalargeuniquetinuturobulongpaalamclearnapabalitapapapuntanagpapasasanagmamadalinamulaklaknagpapakainhoneymoonnabubuhaynalagutannathanniyonpinangalanangjobsabut-abotsabongbagamatfollowingkusinamakausaplunasnarinigkahalumigmiganvarietymaligayahelenamataaastatlomaramotparurusahanpublishing,dreamspinyapropensobutihingayangenerationsoverviewcontinuestructureipinalutosilyakaaya-ayangpsssexhaustedgasmahuhusaynegroseffort,alagangnutrientsbarung-barongpinagtagposponsorships,maglalaronakahigangmeriendamusiciangabi-gabiaktibistanagawangpinaliguanmakidalominu-minutodekorasyonpandidirinakabawimakakakaenpagpanhikmagpapagupitnahahalinhanmaasahanpananglawnapatulalamananalonaghubadpagiisipkabarkadaipinambilikastilaoperativosnagyayanginilabasjackznuhtuvomarangyanginfluencesfireworkstryghedpakainneavotespakpakprobablementegabepatrickipinalitlibagsutilngpuntapa-dayagonallutuinpanghihiyangkinikilalangmakasalanangnasasakupannakakabangonnovellescitizensnakangisiaraw-arawnakapangasawapaghihingalomagpagalingmasaksihancourtkapasyahanbulalaspagbigyanamericafitnesshinahanapnatatawagospelnilaosinstrumentalmabagalhinahaplospadalasminerviedibaejecutantagakmaghatinggabimournedbingozoorefersnahulisinapakremainbinabamichael4thhardreturnedinvolveissueslinggongkailangangipinatutupadpagkaimpaktoperfectambisyosang