Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. En invierno, los árboles pierden sus hojas y se vuelven caducos.

2. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

3. Kung ako si Maico? Malamang magwawala ako. aniya.

4. Håbet om at finde kærlighed og lykke kan motivere os til at søge nye relationer.

5. Many cultures have traditional sweet treats, such as baklava, churros, and mochi.

6. Ituturo ni Clara ang tiya niya.

7. We have a lot of work to do before the deadline.

8. Ang mga eksperto sa kalusugan ay nagbahagi ng kanilang mga mungkahi upang mapabuti ang mga programa sa pangangalaga sa kalusugan.

9. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

10. He pursued an "America First" agenda, advocating for trade protectionism and prioritizing domestic interests.

11. Nakakapagtaka naman na hindi nya ito nakita.

12. Naglakad kami sa gubat na mayabong ng mga punong-kahoy, at naramdaman namin ang sariwang hangin.

13. Les problèmes de santé mentale peuvent avoir des effets physiques et sociaux sur une personne.

14. Medarbejdere kan arbejde i forskellige områder som finans, teknologi, uddannelse, etc.

15. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

16. Nag-aaral si Maya sa Unibersidad ng Pilipinas.

17. Hindi nawawala ang halaga ng panitikan sa pagpapalaganap ng kultura at kaalaman.

18. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

19. Sa gitna ng galit at poot, nahihirapan akong makapagpatuloy sa aking buhay.

20. Las redes sociales tienen un impacto en la forma en que las personas se comunican y relacionan.

21. Ano ang gusto mo, sinigang o adobo?

22. Ang bayanihan ay nagpapakita ng kahalagahan ng pagtutulungan at pagkakaisa sa pagharap sa mga suliranin.

23. Las redes sociales tienen un impacto en la cultura y la sociedad en general.

24. La labradora de mi primo es muy protectora de la familia y siempre está alerta.

25. Awitan mo ang bata para makatulog siya.

26. Budgeting, saving, and investing are important aspects of money management.

27. Cada nacimiento trae consigo la promesa de un futuro lleno de posibilidades.

28. Nagtatanim kami ng mga halamang gamot para sa aming natural na gamutan.

29. Omelettes are a popular choice for those following a low-carb or high-protein diet.

30. Pinaghihiwa ko ang mga kamatis.

31. Pull yourself together and focus on the task at hand.

32. Ang bango ng lupa pagkatapos ng ulan ay nagdala ng mabango at sariwang simoy.

33. Su vida personal fue complicada y difícil, a menudo luchando con la depresión y la soledad.

34. Napakabilis talaga ng panahon.

35. Hindi ko maintindihan kung bakit kailangan pang magmangiyak-ngiyak dahil sa mga simpleng bagay.

36. Sa kanilang panaghoy, ipinakita nila ang tapang sa kabila ng matinding pagsubok.

37. No te preocupes, estaré bien, cuídate mucho y disfruta de tus vacaciones.

38. May gusto ka bang gawin mamayang gabi?

39. Ang pagkakaroon ng sapat na tulog ay nakakatulong sa pagpapanatili ng tamang timbang.

40. Hindi lang si Padre Abena ang gusting tumulong kay Tony maging si Mang Ernan na kasama niya rin sa bilibid

41. Mathematics is the study of numbers, quantities, and shapes.

42. Sa sobrang pagod, nagawa niyang paglimot sa mga pangyayari ng nakaraang araw.

43. Sa paligsahan, pumasok sa entablado ang mga kalahok nang limahan.

44. The bridge was closed, and therefore we had to take a detour.

45. Napatungo ako dahil nangingilid na naman ang mata ko.

46. L'auto-discipline est également importante pour maintenir la motivation, car elle permet de s'engager dans des actions nécessaires même lorsque cela peut être difficile.

47. Some viruses can cause cancer, such as human papillomavirus (HPV) and hepatitis B and C.

48. Las labradoras son una raza de perros muy populares en todo el mundo.

49. Ang pagpapa-tanggal ng ngipin ay ginagawa kapag hindi na maaring malunasan ang sira nito.

50. Madalas siyang sumusulat kapag nag-iisa.

Recent Searches

eskuwelaunti-untifollowing,papanhiknaka-smirkaanhinerhvervslivetnapapatungocouldlobbyculturemorningpinamalagipaanongmakapalagrenekabundukantumagalpagdiriwangpronounmasaktanbayadumangatcombatirlas,diyaryomagamotnatabunannearpaparusahanhinahanapnaglahovillagebisitaencuestasricaartisttatagalfestivalesmoviepagkasabinapapalibutandeterminasyonsusunodmatagumpaykinakaindurantegubatmakilalaproducerersiyudadkargahansementeryomatumallegendkabiyaknaaksidentehaponpagbigyannagagamitnakatitigmagtagolaruinsenadorkumakainlumibotomfattendenagdaosnatitiraumagakumaenmalasutlakatolikolagaslasisubolumbaydakilangpakibigayhinahaplosmagtanimgroceryriegaairplanesfavorsteamshipsuwakminerviehinalungkatkinakaligligshinesgovernorstoyenerginahigakalongproudpresleycarolwikananaysurroundingsvasquesnahintakutannaglakadguardatusindvisnakinigniligawanpaghingimournednakatingingcomunicanaumentaraudienceapoyrevolutionizednapatingindikyamresignationmodernemaluwangisinamalosslinggo1787blazingletterbusogadditionallypreviouslytillsipapromotingdeviceshitnuclearencounterphysicalsuprememuliipinabalikbluebumubulaprovebusinesseskabibipartypumapasoksumusunomestmakulitkapilingstarted:examplewhileguidewindowlutuinwhetherbitbitmariakapangyarihankahongfeedbacksasagutinfilipinobroadcasttitamasiyadoasiaticnabasapaki-ulitmagbantaytingnatagalancondostarredprinsipelumindolosakasimulagamesnagdadasalhardinsalamangkeranaglabakalikasani-collectnag-iisatagumpaynakalabasbawattiyakmanirahanhinilanakilalakatagalmobileshareonetili