Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Inflation kann die Beziehungen zwischen den Ländern beeinträchtigen.

2. La adicción a las drogas puede afectar negativamente las relaciones familiares y de amistad.

3. Hihiga na sana ako nang may kumatok sa pinto.

4. Some couples choose to have a destination wedding in a different country or location.

5. Hindi siya makapagtaas ng mabibigat dahil mababa ang kanyang timbang.

6. Taga-Ochando, New Washington ako.

7. Orang tua bayi sering kali merayakan hari ulang tahun anak mereka setiap tahunnya dengan acara yang meriah.

8. Ang Ibong Adarna ay patuloy na nakakaakit ng mga mambabasa sa ngayon dahil sa kanyang pagpapakita ng kagandahan ng kultura at panitikan ng Pilipinas.

9. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

10. Cuando las plantas tienen al menos dos hojas, trasplántalas al lugar definitivo

11. Inutusan niya si Pinang na magluto ng lugaw.

12. El nacimiento puede ser un momento de reflexión y celebración, y puede marcar el comienzo de una nueva etapa en la vida de la familia.

13. Los agricultores trabajan duro para mantener sus cultivos saludables y productivos.

14. Napakainit ngayon kaya't kinailangan kong nagiigib ng malamig na tubig para sa sarili ko.

15. May bago ka na namang cellphone.

16. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

17. The number you have dialled is either unattended or...

18. Humihingal na rin siya, humahagok.

19. Está claro que el equipo necesita mejorar su desempeño.

20. Halos kassingulang niya si Ogor, ngunit higit na matipuno ang katawan nito.

21. My friend was better off not knowing about her boyfriend's infidelity - ignorance is bliss, or so they say.

22. Parating na rin yun. Bayaan mo siya may susi naman yun eh.

23. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

24. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

25. Les habitudes de vie saines peuvent aider à prévenir les maladies et à maintenir une bonne santé tout au long de la vie.

26. Inflation kann auch durch eine Verringerung der öffentlichen Investitionen verurs

27. Kumakain sa cafeteria ng sandwich.

28. Ang mga sanggol at bata ay madalas na natutulog ng mahabang oras sa isang araw.

29. Ella yung nakalagay na caller ID.

30. Kailangan magpakatotoo at humingi ng tulong kung hindi makakabayad ng utang sa tamang panahon.

31. Boboto ka ba sa darating na eleksyon?

32. Baka matunaw ako. biglang sabi niya. Langya gising pala!

33. Les investissements peuvent générer des rendements significatifs, mais comportent également des risques.

34. Dumadating ang mga guests ng gabi.

35. Magkano ito?

36. Ang ganda pala sa enchanted kingdom!

37. The film director produced a series of short films, experimenting with different styles and genres.

38. Facebook allows users to send private messages, comment on posts, and engage in group discussions.

39. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

40. Medarbejdere kan arbejde på en sæsonmæssig basis, som landmænd.

41. Ano ho ang nararamdaman niyo?

42. Marahil ay hindi pa ito ang tamang panahon upang magpakasal.

43. You reap what you sow.

44. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

45. Isang umaga habang siya ay naglalakad patungo sa kanilang hardin ay may nakasalubong niya ang isang binata.

46. Masayang nakihalubilo si Paniki sa mga mababangis na hayop.

47. Panahon na lang ang hahatol kung nararapat na ngang ibalik sa dating anyo si Kiko.

48. La diversificación de cultivos ayuda a reducir el ries

49. Robusta beans are cheaper and have a more bitter taste.

50. Alam mo ba kung bakit takot si Cross sa hospital?

Recent Searches

following,pesotwitchmagtataposkuwadernoevilpinalitanoperativossections,seainisyumuyukoelectronicpetroleumnapapansinmatindiaplicarmalalimdumaramicubiclecaracterizanaglokoespigaspresyomaskinerspeedpisaragameiiwaninihandatradisyonnanlilisiktreatsmaibibigaykarapatangdarnanapalitangmariepoloseasondollarsahigdahilnakakamitkerbaddresseffectskingtagtuyotsumagotkilomaluwangamericaquarantinebalitaasohihigapaderhabitheartkadalaspagsusulitgirlfriendalas-dosepumasoknaalisnalugodpabiliattractiveslavemaghapongalanganpagtingintsaasiyasinapokgatheringpedemaawaingatinpinangalanantarangkahangasolinahanoverbeenwayswalangdaysaraw-influencesmagbibitak-bitakpalamutikinsemag-alalagagawinkalanatingtakottrapikpresentakaninayearskinuhakailanganmarahilmatuklapmaatimenergijulietmakasakaymansisikatpakukuluandoktororugabarodistancesospitalmadalimataraysadyangnagliwanagmisyunerobertokasiyahanggiveskirtphilosopherinventadobulasang-ayonpantalonghomelagunaaminmahinogimportantesfeelmethodssinumanglansangancanteenheartbreaksapagkatmadilimtumingalamultoifugaoumiiyakpinaulananexhaustionmainitnananaghililapitanlondonpaginiwanperoequipovirksomhederpaskongtaglagaspaumanhinkayasinusuklalyanperamasinopgayatrackmarksarilit-ibanghinabolmind:manatilisampungatensyonabundantecommercepara-parangnagdabogbusabusinrightsrebolusyonpag-aaralhumiwalaykemi,ricamagpalagoniyapublishingsumugodisinumpaditopookminamasdaninterestjuicepoliticspublicationsupilin