Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Sa mga tabing-dagat, naglipana ang mga maliliit na kabahayan.

2. Naramdaman ko ang pagdidilim ng aking paningin nang biglang nagpakalma ang mundo sa aking paligid.

3. Eh? Anlabo? Hindi mo naman kaboses yun eh.

4. Alam kong heartbeat yun, tingin mo sakin tangeks?

5. Umiling ako, Wala naman. Akala ko kasi kakilala mo sya,

6. Ang bobo naman ito, di pa nasagutan ang tanong.

7. Anung email address mo?

8. Ipinagbibili ko na ang aking kotse.

9. Kahit saang parte ng mundo ay may makikita ka pa ring gumagamit ng illegal na droga.

10. Hindi ko alam kung saan ito mag-uumpisa, pero may gusto ako sa iyo.

11. Namatay ang mga pananim at ang tanging natira ay ang mga lasong puno na hitik na hitik sa bunga.

12. Cars were honking loudly in the middle of rush hour traffic.

13. Thumbelina is a tiny girl who embarks on a journey to find true love and her place in the world.

14. Proper training and socialization are essential for a well-behaved dog.

15. Matapos ng ilang araw ito ay namulaklak.

16. No pain, no gain

17. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

18. Der er også mange forskellige former for motion, som kan udføres uden nogen speciel udstyr, såsom gåture og trappetrin træning.

19. Necesito ver a un médico. (I need to see a doctor.)

20. Bigla niyang mininimize yung window

21. Les maladies transmissibles peuvent se propager rapidement et nécessitent une surveillance constante.

22. Malapit ang eskuwela ko sa bahay namin.

23. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

24. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

25. Habang wala pang trabaho ay matuto kang magtiis na asin ang ulam.

26. Nakakasama sila sa pagsasaya.

27. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

28. Wala dito ang kapatid kong lalaki.

29. Ang pangungutya ay hindi magbubunga ng maganda.

30. She has been making jewelry for years.

31. Madami ang nawalan ng trabaho dahil sa pandemya.

32. Television is a medium that has become a staple in most households around the world

33. Børn bør lære om bæredygtighed og miljøbeskyttelse for at bevare vores planet.

34. Sweetness is an important factor in the culinary arts and food industry.

35. Napakalaki talaga ng isla sa boracay.

36. Nakahain na ako nang dumating siya sa hapag.

37. She was born on June 26, 1993, in Boca Raton, Florida, USA.

38. Tengo una labradora negra llamada Luna que es muy juguetona.

39. Inflation kann zu einer Abwertung der Währung führen.

40. Einstein was awarded the Nobel Prize in Physics in 1921 for his explanation of the photoelectric effect.

41. Bakit di mo 'to sinabi sa akin?

42. Si Ogor, na kamakailan lamang ay bumabag sa kanya, ang malimit magsisimula ng panunukso.

43. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

44. Nagliliyab ang mga damo sa bukid dahil sa sobrang init ng panahon.

45. Dinig ng langit ang hiling ni Waldo upang ang paghihirap nila ay mabigyan ng wakas.

46. Work can be challenging and stressful at times, but can also be rewarding.

47. Este plato tiene un toque picante que lo hace especial.

48. Users can like, comment, and share posts on Instagram, fostering engagement and interaction.

49. Party ni Lory? nabigla sya sakin sa sinabi ko.

50. If you think I'm the one who stole your phone, you're barking up the wrong tree.

Recent Searches

following,mataposbantulottinaydancerenacentistamasarapnakakaanimtugonairportyumabongnakakapuntakasaganaankasuutanpulgadaayonmachinesbaoanirosemanilamag-ibaumanoautomationmagtigilmeansbarkomaasahanpatunayanadversehapasintendernagpapaigibmagbibigayiligtasyungpaskongbetweenspeechespagkaraaeducationalsandalinglikuranhankomunikasyonkitamatayogpublicityestateginisingbaldeelectronicdownpinataynuclearhinigitkasitilaanimoymabutinggabi-gabisubalitparurusahansakinhulikarapatangcomuneskayabotonagpuyosnakilalavistsurgeryalbularyokayabanganpresence,kagubatansang-ayonkamalianpagpapasanindustriyacommunitytemparaturapinigilangumuhitniyasadyangmataaaspinangaralanalagapulongpangkaraniwangnagbibigaymagsimulapinilitchecksibiliperseverance,despuesmagandangipinangangakdahan-dahanlabinsiyamgirlmakabawigayunpamaninabutaninilalabaskinauupuangsasagutinmakabilifotosnapakahusaytravelermensahetinakasanikinalulungkotnag-iinomnaka-smirktaga-hiroshimapansamantalanapakahabadadalawsagasaanmawawalamaghaponkuwentomay-bahaytatanggapinmagsungitnilangumingisinapasubsobumagawmateryaleskongresomungkahitumahantsonggomarangalgataskapataganiwanansusunodpropesornagdalamatumalinilabasnasaangtungogumigisingyongipinadalamagsasakanaispetsangcasakanyaiatfneed,niligawanmakasarilingasovelstandpalaydinanastapebevarelalasocietymawalafollowedmaghapongkanayanginiangatitinaasmakakapananakitsunud-sunodisinamanaglulusakmakisuyotelecomunicacionesparinnapatinginbigyanpigingviolenceeducationtibigcnicocarbonkasoymartialnaawapangkatbinibilangjokebilinsiya