Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Ang paglapastangan sa mga batas at regulasyon ay nagdudulot ng kawalan ng disiplina sa lipunan.

2. Minsan lang ako nag mahal ng ganito.

3. Ang Ibong Adarna ay isang sikat na kwento sa panitikang Filipino.

4. Las plantas acuáticas, como los nenúfares, se desarrollan y viven en el agua.

5. Amazon is an American multinational technology company.

6. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

7. The stock market can be influenced by global events and news that impact multiple sectors and industries.

8. The patient was advised to limit alcohol consumption, which can increase blood pressure and contribute to other health problems.

9. Nang marinig ang tawag ng nanay niya, kumaripas ng uwi ang batang naglalaro sa labas.

10. Las compras en línea son una forma popular de adquirir bienes y servicios.

11. Sa aking balkonahe, natatanaw ko ang pagsikat ng araw sa silangan.

12. Le travail est une partie importante de la vie adulte.

13. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

14. La realidad es que a veces no podemos controlar lo que sucede.

15. Work-life balance is important for maintaining overall health and wellbeing.

16. Sadyang kaunti lamang ang alam kong mga lenggwahe.

17. Magsusuot ako ng Barong Tagalog.

18. Si Ana ay marunong mag-dribble ng bola nang mabilis.

19. He won his fourth NBA championship in 2020, leading the Lakers to victory in the NBA Bubble.

20. Ang taong hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan.

21. Musk is the CEO of SpaceX, Tesla, Neuralink, and The Boring Company.

22. Ilan ang silya sa komedor ninyo?

23. El uso de drogas puede ser un síntoma de problemas subyacentes como depresión o ansiedad.

24. Napatingin ako sa kanya bigla, Kenji?

25. Hindi dapat magbigay ng halaga sa mga kababawang bagay tulad ng kasikatan o kasikatan ng mga gamit.

26. Mahalaga ang pag-aaral ng talambuhay ni Marcelo H. del Pilar upang maunawaan ang kanyang papel sa kasaysayan ng Pilipinas.

27. Lazada has a strong focus on customer service and has won awards for its efforts.

28. Limitations can be viewed as opportunities for growth and personal development.

29. The culprit who stole the purse was caught on camera and identified by the victim.

30. Iniisip ko ang aking mga pangarap, datapwat alam kong ito ay magiging mahirap abutin.

31. Kailan siya nagtapos ng high school

32. Napakalamig sa Tagaytay.

33. Si Andres Bonifacio ay isang magiting na bayani.

34. Tesla is an American electric vehicle and clean energy company.

35. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

36. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

37. Mahalagang magbigay ng respeto sa bawat isa, datapapwat ay hindi naman lahat ng tao ay magkakatugma ang mga paniniwala.

38. Sinimulan ko ng i-collect lahat ng bibilhin.

39. Ani Karing ay naiinggit ito kay Bereti dahil nakukuha ang lahat ng gusto.

40. Ang taong maramot ay madalas hindi sinasamahan ng iba.

41. Eating healthy is an important way to take care of your body and improve your quality of life.

42. Anong ginagawa mo? nagtatakang tanong ko.

43. Pakiluto mo nga ng pancit ang mga bata.

44. Sa bus na may karatulang "Laguna".

45. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

46. El aloe vera es una hierba medicinal conocida por sus propiedades curativas para la piel.

47. Aray! Hinde ko naintindihan yung sinabi mo!

48. Ang kwento sa pelikula ay ukol kay Aristotle na lumaban sa katiwalian.

49. Les soins palliatifs et la fin de vie sont des aspects importants des soins de santé.

50. Nahulog ang saranggola sa puno ng mangga.

Recent Searches

following,bakurankasamabutikimontrealhalu-halonagtitindanapakatagalnapabuntong-hiningamedisinahonestoleadinginangvidenskabensumakitgumagamittuwaumuwibipolarinfectioustinaasanbaletoolsnatiranagsusulputanpamimilhingpagkasabipalantandaanpaglipasnanlakifiverrtoynagpapantalkoronahudyatflywaybotenaiinggitnaabutancornercircletumibaytransmitidastatagaltagalabapamamasyalmatayogsaangsapatregularmentepagbabagong-anyootrasnuhsocialnilagangretirarenergimarkednatatawangibabawnapasubsobelectedbabaejosienanigasmay-arinakakadalawipapahingatransmitslasexhaustedheartmahalinmaglalabamagkakapatidmag-inaiyanitinatapatitakisinilangintindihininformationutak-biyainaaminhimselfpumikitlugawmagkaibanghighestdiseasewaggupitgiitgayunmanminuteganunmagdaanpinalutokakilalagandahancalambabinabalikbackadvertisingspendingtapospagkainnapadpadnakangitimagtrabahomabutikumaripaslabingsignalpagdamidoble-karabroadcastsnabubuhaysakupinlivesshadesincreasinglysiglosourceswednesdaysigawjobamanglungkotniyonemocionalpublishing,patrickgumandaconstitutionkadalasbusilakyanattractivetradicionalcocktailtaong-bayanbosespiratahappenedmanirahanmetodiskyumabongmeannagkantahantatayoleadersstreetmaliksibutchseryosongroselumbayalimentospreadalintuntuninchoiiconcasaleytewaiterpawiineithergardenipagbilithenelitevampiresbaroplasaareasfranciscomayodagat-dagatandapatgymambagsinehantanodnagandahanmukhatsakamulihomeinternetkuwebamalumbayisinisigawkawalanmagpa-picturenilapitanforskelulapeasy