Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

2. Ang daming tao sa peryahan.

3. May I know your name so I can properly address you?

4. Tila hindi niya iniinda ang sakit kahit halatang nasasaktan siya.

5. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

6. L'intelligence artificielle peut être utilisée pour aider à la planification urbaine et à la gestion des transports.

7. When we forgive, we open ourselves up to the possibility of reconciliation and rebuilding damaged relationships.

8. I love to eat pizza.

9. The city is home to iconic landmarks such as the Hollywood Sign and the Walk of Fame.

10. Wag ka nang malumbay dahil nandito naman ako.

11. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

12. It was supposed to be a surprise promotion, but the boss let the cat out of the bag during a meeting.

13. Yeah. masayang sabi ni Chad with matching thumbs up.

14. Gusto po ba ninyong lumipat sa ibang kuwarto?

15. Bakit, saan ba ang iyong kaharian? malambing na tugon ng prinsesa.

16. Nagsisilbi siya bilang pari upang magbigay ng espirituwal na tulong sa kanyang mga parokyano.

17. It's a piece of cake

18. Sa bawat pagkakamali, mayroong aral na pwedeng matutunan, datapapwat ay masakit ang mawalan ng pagkakataon.

19. Medarbejdere kan deltage i mentorprogrammer for at forbedre deres færdigheder.

20. Saan ako nag-aaral ng kindergarten?

21. Limitations can be a result of geographic location or access to resources and opportunities.

22. Saan nagtatrabaho si Roland?

23. Yari sa kahoy ang sahig ng bahay ko.

24. Einstein also made significant contributions to the development of quantum mechanics, statistical mechanics, and cosmology.

25. Alles hat ein Ende, nur die Wurst hat zwei.

26. Ang pagpapakalat ng mga mapanirang balita at kasinungalingan ay nagpapahiwatig ng pagiging bulag sa katotohanan.

27. Ang edukasyon lamang ang maipapamana ko sayo.

28. How I wonder what you are.

29. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

30. Pinigilan nya ang mga kamay ko, Wag!

31. Twitter has implemented features like live video streaming, Twitter Spaces (audio chat rooms), and fleets (disappearing tweets).

32. Umutang siya dahil wala siyang pera.

33. Totoo nga! Sa ilalim niyon nakabaon ang gong na susi ng kanilang kasaganaan.

34. Ang tag-ulan ay nagdadala ng mga pagsubok sa mga nag-aaral dahil sa pagkansela ng klase dahil sa malakas na ulan.

35. Los padres pueden prepararse para el nacimiento tomando clases de parto y leyendo sobre el proceso del parto.

36. Bagkus sa pag-ulan, ang panahon ay mainit at maalinsangan.

37. Les enfants ont des besoins de santé particuliers qui doivent être pris en compte.

38. Narinig ko ang hinagpis ng mga magsasaka dahil sa mababang presyo ng kanilang ani.

39. Ang librong ito ay ukol kay mam Luisa na nagbigay inspirasyon sa kanyang mga estudyante.

40. Inalalayan ko siya hanggang makarating sa abangan ng taxi.

41. Algunas personas coleccionan obras de arte como una inversión o por amor al arte.

42. Hindi ko man masabi sa iyo nang harapan, pero crush kita nang sobra-sobra.

43. Forgiving ourselves is equally important; we all make mistakes, and self-forgiveness is a vital step towards personal growth and self-acceptance.

44. They are often served with a side of toast, hash browns, or fresh greens.

45. Les neuroscientifiques étudient le fonctionnement du cerveau et du système nerveux.

46. Isinilang si Apolinario Mabini noong ika-23 ng Hulyo, 1864.

47. Hinugot niya ang susi sa kanyang bulsa at binuksan ang pinto.

48. Sa panahon ng pandemya, yumabong ang paggamit ng mga online platforms para sa mga transaksiyon.

49. Umuwi na ako kasi pagod na ako.

50. Pumunta sila sa albularyo upang magpagamot ng kanyang pananakit ng likod.

Recent Searches

nagkwentofollowing,makauwinakahugnaiisipnaliwanagangumawamagkaharappagkasabiexperience,mauntoghinukaybankmahigpitsakyanumulanproducererkirbyrenacentistaamuyinedukasyonkangkongnakakaanimnararapatpondohagdanjagiyadustpaninventionhumpaylarongtoypapelenergikasakitbigongskyldesbiglacelularespalagiparopalang1954inihandalottoremainbecomeyepduondalawaprinceonlinegransinipangzoommemofeedback,fuebisiggenerationerpangulotandapasokdeathavailablealingtonetteextratwoarmedmotionplatformsemphasiscomunesstoresummitnamingmakidalohapasingiverkasoculpritbumibilipumapasokdi-kalayuanleegbestfriendpag-iinatadvertising,gayunmannaiyaknakasandighinipan-hipanmagpaliwanagcompanynagbantayistasyonnagtalaganakitulogdireksyonmabatongevolucionadokababalaghangpanunuksomaluwaguniversitiesbibilicurtainspunobumagsakdreamsrememberedipagmalaakitawatibokwateranghelpinagsinepulitikotablenatanggapibagoodeveningbitiwantarcilasarameronpageschoolsmaismestterminointroducelarryreservedbiroconvertidasbigasnuclearfiguresmalapitcomplicatedmalimitgabiefficientpuntagitnabridemalakingbagkus,animoysakacrazytumangoinomsana-allhalu-halokuwartoyoupinapanoodkanya-kanyangfilmibinibigaytinaypinagsulatmag-plantiintayinpasyatuminginnanunurikinaiinisanmagamotriegafireworksika-50reportforcespasasaanpagpapatubonanlilimahidmagkasintahannakagawiannagkakakainsalamangkeronagpabakunanaabutanpagkaimpaktonabighanilumakaskumalmaharapanumiisodentrancemagpapigiltabingparaangdiversidadmaghilamostanghali