Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Magsasalita na sana ako ng sumingit si Maico.

2. In conclusion, the telephone is one of the most important inventions in human history

3. Kailangan mo ng matapang na puso upang lumaban sa agaw-buhay na mundo ng negosyo.

4. We were trying to keep our engagement a secret, but someone let the cat out of the bag on social media.

5. Bilang paglilinaw, ang pagsasanay ay para sa lahat ng empleyado, hindi lang sa bagong hire.

6. Workplace culture and values can have a significant impact on job satisfaction and employee retention.

7. Naging tradisyon na sa kanilang baryo ang pagdiriwang ng kaarawan ng kanilang santo.

8. La voiture rouge est à vendre.

9. Punta tayo sa park.

10. Mauupo na lamang siya sa kanyang balde.

11. Ang librong ito ay ukol kay mam Luisa na nagbigay inspirasyon sa kanyang mga estudyante.

12. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

13. Ang tindahan ay nasara dahil sa paulit-ulit na pag-suway sa business regulations.

14. I know this project is difficult, but we have to keep working hard - no pain, no gain.

15. Kailangan kong lumakas ang aking loob upang maalis ang aking mga agam-agam sa aking mga pangarap.

16. Maruming babae ang kanyang ina.

17. La creatividad nos permite expresarnos de manera única y personal.

18. El perro ladrando en la calle está llamando la atención de los vecinos.

19. The crown jewels, including the king's crown, sceptre, and orb, are symbols of royal authority and power.

20. Naisip niya na mas maganda kung nag-iisa siya sa bukid.

21. If you keep cutting corners, the quality of your work will suffer.

22. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

23. L'entourage et le soutien des proches peuvent également être une source de motivation.

24. Waring may bumisita sa bahay kagabi dahil bukas ang pintuan sa umaga.

25. Kailangan nating magbasa araw-araw.

26. The Getty Center and the Los Angeles County Museum of Art (LACMA) are renowned art institutions in the city.

27. Ang pambansang bayani ng Pilipinas ay si Jose Rizal.

28. Kumaripas ng takbo ang batang may dalang bola nang makita ang kanyang nanay.

29. Advances in medicine have also had a significant impact on society

30. Ang mga bata ay masayang lumibot sa hardin, nakikipaglaro sa mga kaibigan.

31. At blive kvinde indebærer at tage ansvar for sit eget liv.

32. Sa kabila ng kanyang yaman, napaka-maramot niyang tumulong sa charity.

33. Sa digmaan, ang militar ang pinakamahalagang sangay ng pamahalaan.

34. May mga kuwento sa baryo na ang albularyo ay minsang nagpagaling ng isang taong naparalisa.

35. Hindi sapat na bukas palad ka lang sa mga panahon na kailangan mo ng tulong, dapat bukas palad ka rin sa mga taong nangangailangan ng tulong mo.

36. As a lender, you earn interest on the loans you make

37. Regular exercise and playtime are important for a dog's physical and mental well-being.

38. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

39. Sayang, jangan lupa untuk makan malam nanti. (Dear, don't forget to have dinner tonight.)

40. Nagsagawa ng seminar ukol kay Marites sa pangangalaga niya ng kalikasan.

41. Ang talambuhay ni Juan Luna ay nagpapakita ng kanyang husay at kagalingan bilang isang pintor.

42. She was feeling tired, and therefore decided to go to bed early.

43. Bigla, mula sa tubig ay isang babae ang lumutang sa hangin.

44. Wolverine has retractable adamantium claws and a regenerative healing factor.

45. Agad silang nagpunta kay Tandang Isko, ang arbularyo sa katabing bayan.

46. Nagitla ako nang biglang umalingawngaw ang malalakas na putok ng paputok.

47. Hindi ko alam kung kailan magiging tamang oras, pero sana pwede ba kita makilala?

48. Don't cry over spilt milk

49. Ang tunay na pag-ibig sa bayan, ay sa sariling wika nagsisimula.

50. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

Recent Searches

following,magkikitapresidentialbooksocietyunitednakakaalamworldyou,commercialdrayberproductsmaiingaynakikini-kinitamagtatanimplantasculturaskarwahengrestauranttaxifilmscultivolot,medicaldownvideos,mamamanhikanhabitpilipinokuyapresidentchristmassuccesspresssongsvarietybabygovernmentincomecommunicateenergyaanhinshoppingsisentahealthkinagalitancommissionnaiwangeducativasmorningtinigilanloveduwendepacienciainternacionaltsongnararamdamanhoyrestawranpalagiblusamagbungayoueuropebokgameshanphonemarketplacesdealleaderscanadakabundukanhotelcountriesipinambilidogspatakbongpresleyadvertisingkamakailanmoneypapelkuneavailablespareteamprocesshigpitanvictoriadiretsahangheartbutmusiciansnapalitangmabigyanumiwaslifevideoafternoonelectionsejecutanusednakalilipashayaanhousegrahamcultivatedhealthierjeepneycover,televisiontenpagkokakbayanipinaulananpamumunobasapinapakaintag-arawmasarapmoviepahiramnalugmokmeaninggenenanalomedya-agwamaalwangdaangafterpagpapasanpapaanotraditionalageskayabanganmakapangyarihangreachjobumiinomofrecennagwalistransportationmagka-babyrimastinioeyedioxidepatientlumingontiyanpinasalamatanmateryalesroommarahascarenapatakboupodeathnalalabikalakiservicestinaposahasboypuntahanrenacentistaroleginacapitalsaritacombatirlas,kamandagtelephoneinilistaanteskabinataankakuwentuhanpuladelvideosbateryatheystaylittlebagentertainmentjudicialwerenanigasabangsamantalangbossinterestssellingconstitutionpaligidjenalateyoung