Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. AI algorithms can be trained using large datasets to improve their accuracy and effectiveness.

2. Arbejdsgivere kan bruge fleksible arbejdsmetoder for at hjælpe medarbejdere med at balancere deres arbejds- og privatliv.

3. Time heals all wounds.

4. Agad niya itong kinuha at isinaboy sa paligid ng salamangkera.

5. Nagsayaw sa entablado ang mga mag-aaral nang limahan.

6. He has been named NBA Finals MVP four times and has won four regular-season MVP awards.

7. The doctor advised him to get plenty of rest and fluids to recover from pneumonia.

8. Nagkagulo sa palengke at kumaripas ng takbo ang mga tao dahil sa maling akalang may sunog.

9. Kahit hindi siya lumingon, para na niyang nakita si Ogor.

10. Naisip nilang tinangka ng kanilang anak na sunugin ang kanilang bahay.

11. Las hojas de los árboles cambian de color en otoño.

12. La paciencia es una virtud.

13. The project gained momentum after the team received funding.

14. Limitations are the boundaries or constraints that restrict what one can or cannot do.

15. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

16. Work can be challenging and stressful at times, but can also be rewarding.

17. Really? What is he doing sa tapat ng room natin?

18. Les hôpitaux peuvent être des environnements stériles pour prévenir la propagation des infections.

19. Ibinigay niya ang bulaklak sa nanay.

20. Many people go to Boracay in the summer.

21. Sa facebook ay madami akong kaibigan.

22. A couple of raindrops fell on my face as I walked outside.

23. Narealize ko sa dakong huli na mahal ko pa rin ang aking ex.

24. Naputol yung sentence ko kasi bigla niya akong kiniss.

25. Eh ano ba talaga problema sa bagong maid mo?

26. Anong oras gumigising si Cora?

27. Nakakapagod pala umakyat ng bundok.

28. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

29. Wala pa ba? seryoso niyang tanong.

30. Ang pagkuha ng sapat na pahinga at tulog ay isang nakagagamot na paraan upang maibalik ang aking enerhiya at sigla.

31. Tanging si Kablan ang may tindahan sa kanilang komunidad.

32. Sa panitikan, maaari nating makilala ang mga kilalang manunulat ng bansa, tulad ng mga makata at nobelista.

33. Las labradoras son perros muy versátiles y pueden adaptarse a una variedad de situaciones.

34. Los agricultores a menudo enfrentan desafíos como sequías, inundaciones y plagas.

35. Elektroniske apparater kan hjælpe med at overvåge og forbedre kvaliteten af ​​produkter.

36. Isang araw, tinikman ni Datu Duri ang isang hinog na bunga.

37. Ang nagmamahal sa sariling bayan, kayang magtiis at magsumikap.

38. Hindi maganda ang resulta ng ginawang pag susulit ni Mikaela.

39. Der er mange forskellige former for motion, herunder aerob træning, styrketræning og fleksibilitetstræning.

40. Tantangan hidup juga dapat menginspirasi inovasi, kreativitas, dan pemecahan masalah.

41. Nahulog ang bola sa kanal kaya’t hindi na nila ito nakuha.

42. They are not shopping at the mall right now.

43. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

44. Emphasis can be used to create a memorable and impactful message.

45. At leve med en god samvittighed kan hjælpe os med at opbygge stærke og tillidsfulde relationer med andre mennesker.

46. Les habitudes de vie saines peuvent aider à prévenir les maladies et à maintenir une bonne santé tout au long de la vie.

47. Nagluto ako ng adobo para kina Rita.

48. Dahil malilimutin ako, nakalimutan ko na naman ang pangalan ng bagong kaklase.

49. Ang tag-ulan ay nagdadala ng mga pagsubok sa mga nag-aaral dahil sa pagkansela ng klase dahil sa malakas na ulan.

50. May biyahe ba sa Boracay ngayon?

Recent Searches

t-shirtfollowing,kwenta-kwentanaka-smirkmagpapabakunasakopkaraokepauwimakalingnakainpaalamsusunodiskedyulloobpoorerbundoklibertyproducerernanamanmatagumpaycosechar,lumindoltagpiangwaterhinogkasoalsokutodestatesalesbagamaaaisshdadalotengakungramonpsychenaglalakadrelievedguerreroeducativaslettergranadamakasarilingkingdombinilhannagpanggapsakaycosechamay-bahayatensyonglasingeropagdiriwangcarseconomicfurycontestbilidivisionmag-asawangnuclearnamanghakerbbanawearawmahiyaipinadalapagpapatubotilgangpagkakayakapkundiituturosong-writingmakitabakemaximizingsoccerkawili-wililumangoynakasuotevenmobilenothingfurtherartificialrolledferrernakapilangnabuhaynapakabilismagsisimulasuzettemagtakaumagawprimerospalibhasanamataynakikitangpaki-drawingsharmainemagkaibanguugud-ugodmagpalibremensajesnagbakasyongobernadorchristmasnagtatampomadilimwalkie-talkienag-poutmakasilongtaun-taonnakuhangnagliwanaghinihintaybeautifulnaawarewardinghalinglingisusuotminatamisafternoonunconventionalnakakapuntapangalananmakatimaskaramagtanimmaisipmatayogimbeskasishoppingsayamagsunogmatabangnetflixtibigproudpaldaumakyaticonicalaalalandeanywheretambayanpigingnamanreachiniwannunolandotrendangerousminu-minutosinapakebidensyanamuhaysamakatuwidnaririnignilinissumamadagaabalagamotmodernenviarexampleneedsayanthreepilingmereechavespecialgabi-gabinungteamconsiderarinalalayannutrientesrose1973jerrymarahilbutinhalehomesdireksyontayoeveningpamumunonaroonkanilanagtitindamakikitanag-aalaytupelokatutubo