Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Pour maintenir sa motivation, il est important d'avoir des objectifs clairs et réalisables.

2. Eine hohe Inflation kann die Investitionen in die Wirtschaft verlangsamen oder sogar stoppen.

3. Ikaw ang bumitaw! hila-agawan ang ginagawa namin.

4. Kay hapdi ng kanyang batok at balikat.

5.

6. La paciencia es necesaria para alcanzar nuestros sueños.

7. Ang pasaway na estudyante ay na-suway nang paulit-ulit ng kanyang guro.

8. Hindi na niya napigilan ang paghagod ng kanin sa kanyang plato at naglalaway na siya.

9. Bumisita kami sa mga kaibigan namin sa kanilang bahay sa hatinggabi.

10. Let's not make this into a big deal - it's just a storm in a teacup.

11. Tumayo yung limang babae at lumapit kay Kerb.

12. Hindi ka lang nabigyan ng pansin nag tatampo kana!

13. Langfredag ​​mindes Jesus 'korsfæstelse og død på korset.

14. The decision to release the product early was a risky but ultimately successful strategy.

15. Wala kang kuto noh? nabigla ako ng magsalita sya.

16. They plant vegetables in the garden.

17. Isang magnanakaw ang nagsanib-puwersa upang mabuksan ang vault ng bangko.

18. At være transkønnet kan påvirke en persons mentale sundhed og kan føre til depression, angst og andre psykiske udfordringer.

19. Gusto mong makatipid? Kung gayon, iwasan mong gumastos sa mga di-kailangang bagay.

20. Leonardo da Vinci diseñó varios inventos como el helicóptero y la bicicleta.

21. Tulala siya sa kanyang kwarto nang hindi na umalis ng buong araw.

22. Puwede bang pahiram ng asukal? Magluluto ako ng cake mamaya.

23. Gusto kong matutong tumugtog ng gitara.

24. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

25. Napatingin siya sa akin at ngumiti.

26. Sa kabila ng pag-usbong ng modernong medisina, nananatili pa rin ang tiwala ng marami sa albularyo.

27. Nationalism can have a positive impact on social and economic development.

28. Foreclosed properties may be sold in as-is condition, which means the buyer may have to make repairs or renovations.

29. Ipantalop mo ng kamote ang kutsilyo.

30. Kumaripas ng takbo ang kabayo nang bumitaw ang sakay nitong tao.

31. However, excessive caffeine consumption can cause anxiety, insomnia, and other negative side effects.

32. Bukas ang biyahe ko papuntang Manila.

33. Buenos días amiga

34. La realidad es que necesitamos trabajar juntos para resolver el problema.

35. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

36. The internet is full of fashion blogs. They're a dime a dozen.

37. I always feel grateful for another year of life on my birthday.

38. The musician released a series of singles, leading up to the release of her album.

39. Naririnig ko ang halinghing ng mga kalahok sa obstacle course race.

40. Nakakatawa? mataray na tanong ko sa kanya.

41. H-hindi na sabi eh! inis na sabi nya.

42. Gusto ni Itay ang maaliwalas na umaga habang umiinom ng kape.

43. Les travailleurs doivent respecter les heures de travail et les échéances.

44. Dahan-dahan niyang iniangat iyon.

45. Paano daw siya natalo ng isang matanda na mahina na ang mata at uugod-ugod pa.

46. Kailangang pag-isipan natin ang programa.

47. Nakita ko namang natawa yung tindera.

48. Pagkababa, mabilis na siyang nagyayang umuwi.

49. Es importante elegir un powerbank de buena calidad para garantizar una carga segura y eficiente.

50. Musk has been involved in various controversies over his comments on social and political issues.

Recent Searches

inferioresfollowing,nagpaalamnahawakantiniradornasasabihannagpapaigibnabalitaankumakalansinggeologi,nakabulagtangikinagagalaknagkakatipun-tiponlaylaymahinogmensaheairportpansamantalapanalanginpagkasabiculturepahahanapdiretsahangagaddiinibinigayfactoresnatatawamagpapigilpagkagisingasignaturamaintindihanmagandanglumindolpagbibirokulturisinusuottinuturonagsilapithahahamahabangtumamaisipanminahanampliabunutandealmahigitretirarasahanhatinggabikasaysayanatinmoodjaceipanlinisbroughtsubjecttuwangsukatwestpagkatnakinigbinibilinapapikitmariloubutidialledhinintaycocktailgamotdeteriorateloansingatannoodulottillcapitalsupremevehiclesiatfnoblebevaremalakikikocomputere,happenedelectoralgagsiglamarahilulinghomeworkpalagingabstainingcondotomarproveyanmulipakpakfistsitimtopic,bigdidleeilankararatingsabifeedbackhelloreadmaputiwouldipagtimplabroadnagginghelpfulconectanincludebehavioreffecterrors,increasestipinfinityexisteffectsnaniniwalaumiibiggiyerapangungutyamentalhinipan-hipankapatawarankumampikinuskospaghangaisinagotnapilitangcoughingkambingninongpanaymurangdelebellpasyalanlockdownposterlightstaga-hiroshimaeksamcountlessbowadaptabilityhigitibototuloynapatawadtinulak-tulaksegundogalitmeronkayamasasarapkasabaymaghilamosincidencetungkodkotsenapaiyakchadtumapospinakamagalinglumulusobochandoanimcomplicatedkumalmakababalaghangnagsasagotmusiciansnaglakadvillagemagtigilrawalbularyoforcesmamisumalahanditomajormaaringgandamagkaibangmakangitiisulat