Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Kapag mayroong sira sa ngipin, kailangan ng agarang aksyon upang hindi lumala pa ang problema.

2. Les enseignants doivent planifier leurs cours en fonction des objectifs d'apprentissage.

3. Ang pagkakaroon ng mga programa at kampanya sa paglaban sa droga ay mahalaga upang maiwasan ang pagkalat nito sa lipunan.

4. Ano ang ginawa niya pagkatapos ng giyera?

5. The host introduced us to his wife, a beautiful lady with a charming personality.

6. Beauty. si Maico sabay yakap sa akin mula sa likod.

7. Nagsisilbi siya bilang pari upang magbigay ng espirituwal na tulong sa kanyang mga parokyano.

8. Sino-sino ang mga inimbita ninyo para manood?

9. Nagsagawa ang pulisya ng mga raids sa mga tahanan ng mga kilalang salarin sa lugar.

10. Kailangan nating magsumikap datapapwat marami tayong mga hamon sa buhay.

11. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

12. May kanya-kanyang bayani ang bawat panahon.

13. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

14. Minsan ay isang diwata ang nagpanggap na isang babaeng madungis.

15. Ano ang gagawin ni Trina sa Oktubre?

16. The platform offers various filters and editing tools to enhance the appearance of photos before posting.

17. Les enseignants doivent collaborer avec les parents et les autres professionnels de l'éducation pour assurer la réussite des élèves.

18. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

19. James Monroe, the fifth president of the United States, served from 1817 to 1825 and was known for his foreign policy doctrine that became known as the Monroe Doctrine.

20. Agosto pa lamang ay may mga pang paskong dekorasyon na sa mga malls.

21. Det er vigtigt at skabe en inkluderende og støttende samfund for transkønnede personer og bekæmpe diskrimination og intolerance.

22. Børn bør lære om bæredygtighed og miljøbeskyttelse for at bevare vores planet.

23. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

24. Ang paglapastangan sa kalikasan ay nagdudulot ng malalang epekto sa ating kapaligiran.

25. I have been watching TV all evening.

26. Le musée d'Orsay est un incontournable pour les amateurs d'art.

27. May himig pangungutya ang tinig ng pulis.

28. Hindi dapat natin kalimutan ang kabutihang loob sa mga taong nangangailangan, samakatuwid.

29. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

30. Fundamental analysis involves analyzing a company's financial statements and operations to determine its value.

31. Pumasok sa pintuan ang mga atleta nang limahan bago magsimula ang laro.

32. Hay muchos géneros de música, como el rock, el pop, el jazz y el clásico.

33. Ang dentista ay maaaring magbigay ng payo tungkol sa tamang pagsisipilyo at pagsisinok ng ngipin.

34. AI algorithms can be used to analyze large amounts of data and detect patterns that may be difficult for humans to identify.

35. Musk has been described as a visionary and a disruptor in the business world.

36. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

37. Ano ang ginagawa mo nang lumindol?

38. Morgenstund hat Gold im Mund.

39. Nagulat ako sa kanyang biglaang pagbisita, ngunit ito ay nagdulot ng kasiyahan sa aming pamilya.

40. Les soins de santé mentale de qualité sont essentiels pour aider les personnes atteintes de maladies mentales à vivre une vie saine et productive.

41. Nagbabaga ang usapan ng mga opisyal sa harap ng media dahil sa kontrobersiya.

42. Binabasa ng mga mag-aaral ang talambuhay ni Emilio Aguinaldo para mas maunawaan ang kasaysayan ng Pilipinas.

43. The scientific method is used to ensure that experiments are conducted in a rigorous and unbiased manner.

44. Mula sa kinatatalungkuang giray na batalan, saglit siyang napatigil sa paghuhugas ng mumo sa kamay.

45. Les travailleurs peuvent travailler dans une variété de domaines tels que la finance, la technologie, l'éducation, etc.

46. Nahanap niya ang nawawalang susi sa ilalim ng tarangkahan ng kotse.

47. Hindi siya maramot sa pagbibigay ng kanyang mga lumang damit sa mga nangangailangan.

48. El internet ha hecho posible el trabajo remoto y la educación a distancia.

49. Kumusta? Ako si Pedro Santos.

50. Maraming mga mahuhusay na maghahabi ang tumaggap sa hamon ng batang si Amba.

Recent Searches

cultivarfollowing,miyerkolespamahalaankarwahengmagpakasalforskel,sumusulatgreenhillspagpanhikhampaslupanakabawikasiyahanpagkasabimaisusuotkumaripaslaborsampaguitahelpfulnapahintodosenangdiinkumampinasisilawpictureskaklasekolehiyomagkasakitre-reviewhaponlaganapmakatiexigentebinabaratmusicalcaraballopauwiresearch,nanamankapataganvictoriaeksperimenteringnochemayabongtanawmarielmagdaanmerchandisearegladonatawahalu-halokapalpinilitnapadaanloveenerginetflixbulaktoytelefonknightpulissinakopsistermissionvivasong-writingaksidentepusanglumuwasmalawakkalakistonehamerapnaiyakcover,palagingtalagangnakakapuntapatulogkalalakihanvankontracuentanmemoriahoylupaanitotinioasopaghingicitizeniconsutilizarlumilingongoalmay-bahaydidmakahihigitnaguguluhangfiststabiwellcompartenpasokchangeinisneroexpertnapawinapasubsobekonomiyakangitancharmingsystems-diesel-runsumasakaybeautifulkaraniwangkaninaroquetalanagtatanongkinuhabikolpersonalipinabaliklorimulighedtonnuonvampiresnitongwidespreadsamfundsakinspecialgagamitinverysteamshipskamiaswhetheripinalitsofaknowledgeelectedpromotingeyedulaheinothingeksenacigarettepagkataobukaskuripotseguridadgardennakapasaahitmakakatakasburmalarotipiditemssakupinkarunungannakakunot-noongcancerinvestingagaw-buhaybakallumahokkantananlalamighmmmculturasdivisionpisonakataposcoachingmalikotmanalokadalagahangibabaauthorpatunayanmag-asawaspeechhistorynag-aalalanglumungkotmenoskulunganibonpagkuwanlalotig-bebentefilipinoinantokpagkagalit