Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. To: Beast Yung friend kong si Mica.

2. Maaaring magdulot ng stress at takot ang pagpunta sa dentista, ngunit mahalagang malampasan ito upang maiwasan ang malalang dental problem.

3. Ang tag-ulan ay kadalasang panahon ng pagtatanim ng mga halaman at tanim dahil sa malakas na pag-ulan.

4. Eine hohe Inflation kann zu einem Anstieg der Zinsen führen, um den Anstieg der Preise auszugleichen.

5. Hindi ho, paungol niyang tugon.

6. Ang sobrang pangamba ay maaaring magdulot ng kakulangan sa kumpyansa sa sarili.

7. Sakay na! Saan ka pa pupunta?!!

8. Naglalaway ako sa amoy ng niluluto mong adobo.

9. Gusto ko sanang bumili ng bahay.

10. It encompasses a wide range of areas, from transportation and communication to medicine and entertainment

11. Walang password ang wifi ng kapit-bahay.

12. L'intelligence artificielle peut aider à optimiser les processus de production industrielle.

13. Limiting alcohol and caffeine intake can improve overall health.

14. Kailan itinatag ang unibersidad mo?

15. Ang sugal ay maaaring magdulot ng pagsisira sa relasyon at pamilyang pinansyal.

16. Ang lalaki ng isdang nahuli ni itay.

17. Maaliwalas ang paligid sa bukid tuwing madaling araw

18. Naglakad ang mga sundalo sa kalsada nang limahan.

19. Las vacaciones son un momento para crear recuerdos inolvidables con seres queridos.

20. Lending money to someone without collateral is a risky endeavor.

21. I do not drink coffee.

22. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

23. Kapag ang tao ay may tiyaga, kahit maliit na bagay ay may tagumpay.

24. Tesla's vehicles are equipped with over-the-air software updates, allowing for continuous improvements and new features to be added remotely.

25. Magandang gabi sa inyo mga ginoo at binibini.

26. Limitations can be self-imposed or imposed by others.

27. Beauty. si Maico sabay yakap sa akin mula sa likod.

28. Ang kuripot ng kanyang nanay.

29. At have et håb om at blive en bedre person kan motivere os til at vokse og udvikle os.

30. Limitations are the boundaries or constraints that restrict what one can or cannot do.

31. Ang pagbisita sa mga magagandang tanawin o pook turistiko ay isang nakagagamot na paraan upang mabawasan ang stress.

32. At have en klar samvittighed kan hjælpe os med at træffe de rigtige beslutninger i pressede situationer.

33. Umupo sa harapan ng klase ang mga mag-aaral nang limahan.

34. Ang bilis nya natapos maligo.

35. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

36. I am absolutely confident in my ability to succeed.

37. May problema ba? tanong niya.

38. I am working on a project for work.

39. Ang pagpapalinis ng ngipin ay mahalaga para maiwasan ang mga sakit sa bibig.

40. May mga turista na nagpasyang lumibot sa pamamagitan ng bisikleta para mas mapadali ang kanilang paglalakbay.

41. Nationalism can be a source of conflict between different groups within a nation-state.

42. Ang tagumpay ng ating bayan sa larangan ng sports ay ikinagagalak ng buong bansa.

43. Napahinga ako ng malakas kaya napatingin siya sa akin

44. Dahil dito ang mga tao ay laging may mga piging.

45. A couple of phone calls and emails later, I finally got the information I needed.

46. LeBron James is an exceptional passer, rebounder, and scorer, known for his powerful dunks and highlight-reel plays.

47. The website has a lot of useful information for people interested in learning about history.

48. Pakipuntahan mo si Maria sa kusina.

49. Dahil sa pagod, naupo ang matanda sa ilalim ng nasabing puno upang makapagpahinga.

50. Algunos powerbanks tienen múltiples puertos USB para cargar varios dispositivos al mismo tiempo.

Recent Searches

disenyongfollowing,nagpapakainmagpaniwalamaratingnagulatmaayosmadalingikinamataycultivonapaplastikannagkakatipun-tiponbungamalayapagkasabihouseholdsnakaangatpagkagustopresence,masinophulihannapatulalalumilipadmananalosundalogovernmenttataaskinabukasannakabiladkindergartenfurtherteamconsiderarpasokbussinong1973hampaslupaginangbibilhinbankdealjeepneymasungitmandirigmangproducerernapansinuniversitynahahalinhannatatawasinisirakapilingpantalonelladagatalas-dosearmedbitawanplasainislalongparehasperwisyowonderbirdskabarkadadoesgeneratedfeedbackconditionmeresummitnothingbalotenergitelefonkulottrajekasaysayansana-allmangungudngodingatangoalcassandrabumigayartiststoypasyamarchpakpakmadamiweddingnoopioneernakikitasimbahanmulighederdiretsahang1980gigisingsmilenagsuotabenemisteryokatolisismobagamaplayeddalawaipaalamrodonakamalayansugatangsentimoskanannapakahangaimporhiwawantkomunikasyonnakatindigflamencobumotojenalisensyatoribiobisigasinkantobakitblusasayastyrerupontapatfredreadingmatalinotatloraymondwalang-tiyakbutchprosesopangungusapnakaraangmakidalosinampalbibisitamakuhangnageenglishburolhinanapadvancementmaramotsikkerhedsnet,colorfestivalesmagtatanimmatapospusoreguleringtryghedrepresentedmapuputiginawangparaanggamitinalas-diyesagilamakikipaglaroosakanailigtasaninohimihiyawisasagotmaghihintayebidensyaika-50pasensyaiiwasanmamarilpangilpananghaliantravelbritishneasinehamakoktubreexpresangayundinrepublicanbuwayagubatnakatirapansamantalapuedeorderinareasestadospersonal