Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Sa pagsasagawa ng outreach program, ang bayanihan ng mga organisasyon ay nagdulot ng pag-asa at pag-asa sa mga benepisyaryo.

2. Les étudiants peuvent étudier à l'étranger dans le cadre d'un programme d'échange.

3. Sa gitna ng pagdidilim, napansin ko ang nagliliwanag na ilaw mula sa aking bahay.

4. Pumunta ang pamilyang Garcia sa Pilipinas.

5. Kumaliwa ka sa susunod na kanto.

6. They have been volunteering at the shelter for a month.

7. Sa gitna ng krisis, marami ang nagkakaroon ng agam-agam sa kanilang kinabukasan.

8. Nakipagtagisan sya ng talino sa kapwa estudyante.

9. Dala ng hinagpis, nagdesisyon si Mario na magpakalayo-layo upang muling hanapin ang sarili.

10. Laging sinusuklalyan ng kaniyang ina na si Aling Pising ang kaniyang buhok.

11. Pumasok sa pintuan ang mga atleta nang limahan bago magsimula ang laro.

12. Magmula noon nakilala na sa Palawan ang pating.

13. Kucing di Indonesia juga terkenal dengan kebiasaan mereka untuk menjilati bulunya untuk menjaga kebersihan.

14. Nakatapos na ako ng thesis kaya masayang-masaya ako ngayon.

15. Dogs can provide a sense of security and protection to their owners.

16. Have they fixed the issue with the software?

17. Les personnes âgées peuvent avoir des difficultés à se déplacer ou à effectuer des tâches quotidiennes.

18. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

19. Ibinigay niya ang kanyang talento at galing sa musika upang mapasaya ang marami.

20. ¿Cuántos años tienes?

21. Sa pag-alis niya sa tahanan, nag-iwan siya ng mga alaala at mga kuwentong puno ng pagmamahal.

22. Les patients peuvent être transférés dans des unités de soins spécialisées en fonction de leur état de santé.

23. En otoño, es el momento perfecto para cosechar las aceitunas y hacer aceite de oliva.

24. Les examens et les tests sont des évaluations importantes pour les étudiants.

25. Anong tara na?! Hindi pa tapos ang palabas.

26. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha evolucionado para incluir un

27. Emphasis can help clarify and reinforce the meaning of a message.

28. Sa paggamit ng mga social media, huwag magpabaya sa privacy at kaligtasan ng mga personal na impormasyon.

29. He starred in a number of films in the 1950s and 1960s, including Love Me Tender, Jailhouse Rock and Viva Las Vegas

30. Nakatayo siya sa gilid ng bangin, waring nag-iisip nang malalim.

31. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

32. The event was sold out, and therefore we couldn't get tickets.

33. Lagi na siyang tulala, hindi na siya halos nakakapasok sa paaralan at lagi lang siyang nasa simbaha't nagdarasal.

34. Lumiwanag ang paningin ko sa paliwanag ng guro.

35. Nagsimula ang programa sa dakong huli ng gabi.

36. The potential for human creativity is immeasurable.

37. Digital oscilloscopes convert the analog signal to a digital format for display and analysis.

38. Las heridas por quemaduras pueden necesitar de tratamientos específicos, como el uso de cremas o apósitos especiales.

39. Hindi lahat ng tao ay bukas palad, kaya kailangan mong mag-ingat sa mga taong pwede kang masaktan.

40. La poesía de Neruda tiene una elegancia sublime que conmueve al lector.

41. Scissors should be handled with care to avoid injuries and kept out of reach of children.

42. Magandang maganda ang Pilipinas.

43. If you think he'll agree to your proposal, you're barking up the wrong tree.

44. Magkaiba man tayo ng landas ay tiyak kong magkikita pa din tayo.

45. Bigyan mo muna ako ng dahilan kung baket. sabi ko.

46. Make a long story short

47. Kung may mananagot niyan ay walang iba kundi ang pobreng tsuper.

48. Nogle helte går frivilligt ind i farlige situationer for at redde andre.

49. Dapat nating isaalang-alang ang mga posibilidad ng bawat desisyon, datapapwat ay hindi natin alam ang mga mangyayari sa hinaharap.

50. AI algorithms are constantly evolving and improving, with new advancements being made in fields such as deep learning and reinforcement learning.

Recent Searches

following,na-curiouspagkasabikabiyakdetmaingayeksport,blueherunderbakaalinmarilouhimutokenergicitizenselectedneedsmagpa-paskomaipantawid-gutompakikipaglabankatulongandbadingclubrecentbadtripenterjamesdiwatafiancekasamamagkasakitkampokumampinaiinismenosmanakbosantosautomationanitoparangpopcornpag-aminpakpak1000sakinrelopasangnakikilalangagricultoresnagmakaawamakakatakasnakitaagwadorpagluluksanakapagreklamopunongkahoymagbabakasyonkalayuannalugmoknagliwanagmasayahinminamahalkumaliwakare-karenakatayokikitamagpaliwanagnanahimikpinakamatabangerhvervslivetunti-untingdoble-karamalulungkotnami-misskamiasnaghihirapi-rechargeibinilipacienciatinakasansinaliksikyumabongnapipilitankasiyahanexhaustionnakakarinignakarinigfulfillmentkristocanteenibinaonnapasubsobsignaldiferentesusuariopakukuluancorporationhanapbuhaymaghapongandreavegaspalayotulongnagsimulakatibayangwakasumiwashumihingitalagangpumikitkapwapinaulananmisteryotawanapapatingineksportenlabahinumibigalleabutansagotmerchandiseasahanmartiannuevoabigaelproductsnilolokopublicitytenernanaymakinangkuwebabinibilangrememberednatulakangkanangeladiseaseselenamonumentodisselaybraripangalanhundredgardenmatulisthankkaarawanisamakontingtiningnansapatinakyatkatagalaninspiredbingianaydahaniiklitwo-partyoperahanindiaayokopatayareaschoinaggalapakilutotinitirhanallottedipatuloybitiwanburmaadversegenecasabarrocoiniinomwerebiglamedidatransmitspunsolorioueelectionspagemayoestablishtryghedpinalutohangaringritoahitminutousadoktor