Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

2. Women have been instrumental in driving economic growth and development through entrepreneurship and innovation.

3. Noong una ayaw nilang paniwalaan ang bata ngunit di naglaon ay tinikman din nila ito at napag-alaman ngang matamis ang bunga.

4. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

5. Sa dapit-hapon, masarap mag-picnic kasama ang pamilya at kaibigan.

6. The children play in the playground.

7. Una conciencia clara nos da la fuerza y la confianza para hacer lo correcto.

8. Les ingénieurs appliquent la science pour créer des produits et des systèmes.

9. Napuyat ako kakapanood ng netflix.

10. Magaling na ang sugat ko sa ulo.

11. Tumindig ang pulis.

12. The company burned bridges with its customers by providing poor service and low-quality products.

13. Nagtatanong ako sa kanya kung ano ang mga gusto niya upang masiguro na magugustuhan niya ang aking mga regalo.

14. He has been practicing basketball for hours.

15. Nagbabaga ang pakiramdam ng kanyang balat dahil sa matagal na pagkabilad sa araw.

16. Sa muling pagkikita!

17. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

18. Los bebés pueden necesitar cuidados especiales después del nacimiento, como atención médica intensiva o apoyo para mantener la temperatura corporal.

19. Seguir nuestra conciencia puede ser difícil, pero nos ayuda a mantenernos fieles a nuestros valores y principios.

20. Hindi niya inaasahan ang biglaang pagbisita ng kanyang kaibigan.

21. Todos necesitamos algo en qué creer y esperar en la vida. (We all need something to believe in and hope for in life.)

22. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

23. The little boy was happy playing in his sandbox, unaware of the problems of the world - ignorance is bliss when you're that age.

24. Después de lavar la ropa, la puse a secar al sol.

25. Sa ganang iyo, dapat bang manatili sa kanilang posisyon ang mga opisyal na hindi epektibo?

26. Different religions have different interpretations of God and the nature of the divine, ranging from monotheism to polytheism and pantheism.

27. Børn skal have mulighed for at udtrykke sig og udvikle deres kreative evner.

28. Scientific data has helped to shape policies related to public health and safety.

29. It's important to consider the financial responsibility of owning a pet, including veterinary care and food costs.

30. Tumawa siya. Thank you Jackz! See ya! Bye! Mwuaaahh!!

31. I used my credit card to purchase the new laptop.

32. I've been following the diet plan for a week, and so far so good.

33. Maluwag ang parisukat na sementong kinatitirikan ng gripo at ang dulo ng pila'y nasa labas pa niyon.

34. Magtatanim kami ng mga puno sa isang linggo.

35. El parto puede ser natural o por cesárea, dependiendo de las circunstancias y la salud de la madre y el bebé.

36. May bagong batas na ipinatupad ukol sa proteksyon ng mga manggagawa.

37. Ang suporta ng pamilya ni Carlos Yulo ang naging pundasyon ng kanyang tagumpay.

38. The stock market gained momentum after the announcement of the new product.

39. After months of hard work, getting a promotion left me feeling euphoric.

40. The task of organizing the event was quite hefty, but we managed to pull it off.

41. Hindi po ba banda roon ang simbahan?

42. Bagama't nawalan ng kapangyarihan ay naging maligaya naman ito sa piling ni Ramon at ng kanilang mga anak.

43. Naisip niya na mas maganda kung nag-iisa siya sa bukid.

44. Nahuli ng guwardiya ang magnanakaw habang ini-inspect ang kanyang bag.

45. Don't worry about making it perfect at this stage - just get your ideas down on paper

46. En boca cerrada no entran moscas.

47. La tos puede ser causada por una variedad de factores, incluyendo alergias, infecciones y enfermedades pulmonares.

48. Sayang, jangan lupa untuk makan malam nanti. (Dear, don't forget to have dinner tonight.)

49. Fødslen kan føre til hormonelle og følelsesmæssige ændringer, så det er vigtigt at tage sig af sin mentale sundhed.

50. Sa ilang saglit ang matandang babae ay naglaho at ang lugar na dating kinatitirikan ng kanyang bahay ay naging lawa.

Recent Searches

nanahimiknakapaligidfollowing,kasintahanlalakidiwatamagsusuotkidkiranlinggongbulaklakpagkasabitumatanglawmagkasakitumiisodnakahugnaglulutomagturomakauwisaan-saanmaibibigaysistemasnatabunaninterests,navigationtotoobihiranginloveestasyonlumabasculturasbatopakilagaytanyagnagplayescuelasdecreasedtinanggaltsonggotuyobintanamaramotbopolsnanoodhumigapatongyamantawabunutanimportantekaninapagtatanonglazadanakinigituturocarolguidancekambingtomorrownakatinginestiloscoalcharismaticpasalamatananiyaenergitoyinangmaidlinawalexandersupremecomputere,dangerouslandonoblemapaibabawaabotdyiporugagamotclientskablanmaiscupidestarcalciumisipwidespreadsakinbroughtbusyangnilinisfakewowmemorialkilalang-kilalacoaching:unchecked1973pagesinabireservationdevelopedreduceddeathmapadalieducationalnutrientespalayanthroughoutipipilitbigcadenaeveningetofredmotionlibagthingobstaclestelevisedlimitclientemaratingbilingworkingelecteditemsenternahigitannakalipassimonpananakitweremahinahongsumibolexpressionsconsiderartumambadtamadmatustusantilapamilihang-bayaninaabotpasasaancornerandamingnakasakitpag-aaralmicaourlihimdisseconclusionmedidabulalasautomatisknatatawamarketing:nagdalapinangaralanpasaheromauupohaponisinagotnagngangalangkadalagahangpagkakatayovirksomheder,tumatawadgabrielpinakamagalingnalalaglagpamburapinapakiramdamannagtrabahopinakamatabanginspirasyonnaglalakadmakuhasakristanhitsurapinakabatangpumapaligidculturalmahahanaynagawangtravelnapasigawihahatidmahahaliknakatapatmakatatlopaglakiselebrasyonpaglisantelephonenagdabogberegningermanahimik