Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. You're stronger than this, pull yourself together and fight through the tough times.

2. The city is home to iconic landmarks such as the Hollywood Sign and the Walk of Fame.

3. Hindi ko kaya itago ang aking damdamin, kaya sana pwede ba kita ligawan?

4. Narinig ko ang lagaslas ng tubig mula sa shower.

5. Pagpasensyahan na daw niya ito dahil iyon na lamang ang natitira niyang pagkain.

6. Effective representatives possess strong communication, leadership, and negotiation skills to effectively represent their constituents' interests.

7.

8. Kebebasan beragama dijamin oleh konstitusi Indonesia dan dihormati dalam kehidupan sehari-hari.

9. Las escuelas pueden ser administradas por el gobierno local, estatal o federal.

10. El cordón umbilical, que conecta al bebé con la placenta, será cortado después del nacimiento.

11. Candi Prambanan di Yogyakarta adalah candi Hindu terbesar di Indonesia dan merupakan situs warisan dunia UNESCO.

12. Binantaan ng mga sibilyan ang magnanakaw bago ito tumakas.

13. The zoo houses a variety of animals, including lions, elephants, and giraffes.

14. Mathematics has many practical applications, such as in finance, engineering, and computer science.

15. AI algorithms are constantly evolving and improving, with new advancements being made in fields such as deep learning and reinforcement learning.

16. Nakita kita kanina, at nagtataka ako kung sana pwede ba kita makilala?

17. Les travailleurs peuvent être affectés à différents horaires de travail, comme le travail de nuit.

18. Les personnes âgées peuvent avoir des difficultés à mémoriser et à apprendre de nouvelles informations.

19. Sa kabila ng hirap, ang kanyang loob ay hindi kailanman naging mababa.

20. Huwag mong hiramin ang aking payong dahil umuulan pa rin.

21. The Easter Island statues, known as Moai, are a mysterious wonder of ancient stone sculptures.

22. Napag desisyonan ko na. Love is sacrifice, right?

23. Nagitla ako nang biglang umalingawngaw ang malalakas na putok ng paputok.

24. The TikTok algorithm uses artificial intelligence to suggest videos to users based on their interests and behavior.

25. Ku, e, magkano naman ang laman? ang tanong nga babae

26. Kalaro ni Pedro sa tennis si Jose.

27. Siya ay nanalangin para sa kaluluwa ng kanyang yumaong kaibigan upang ito'y makalaya na mula sa purgatoryo.

28. Ang paborito niyang laruan ay Beyblade.

29. Kanino humingi ng tulong ang mga tao?

30. Hulk is a massive green brute with immense strength, increasing his power the angrier he gets.

31. Napansin ng kanyang mga kaibigan na maramot siya sa pagpapakita ng emosyon.

32. Emphasis can help to ensure that a message is received and understood by the intended audience.

33. Sana, binigyan mo siya ng bulaklak.

34. Ang mabuti ho yata, e dalhin na natin iyan kung dadalhin.

35. Wait lang ha kunin ko lang yung drinks. aniya.

36. Muchas serpientes venenosas poseen colmillos huecos a través de los cuales inyectan veneno en sus presas.

37. Tila may pagdududa siya sa katapatan ng kanyang kaibigan.

38. Monas di Jakarta adalah landmark terkenal Indonesia yang menjadi ikon kota Jakarta.

39. The exhibit features a variety of artwork, from paintings to sculptures.

40. Kings may have ceremonial duties, such as opening parliament or receiving foreign dignitaries.

41. I admire the perseverance of those who overcome adversity.

42. Alles hat ein Ende, nur die Wurst hat zwei.

43. Los padres sienten un inmenso amor y conexión instantánea con su bebé desde el momento del nacimiento.

44. Sasabihin ko na talaga sa kanya.

45. Sabi ng mga teologo, ang pag-aari ng simbahan ay nagbibigay kaligtasan sa mga kaluluwa mula sa purgatoryo.

46. Pinakain ni Rose si Mrs. Marchant ng almusal.

47. Nagtatanim ako ng mga gulay sa aking maliit na taniman.

48. Les travailleurs peuvent travailler de manière saisonnière, comme les agriculteurs.

49. Magkano ang isang kilong bigas?

50. Es freut mich, Sie kennenzulernen. - Nice to meet you.

Recent Searches

following,namingenhederpanghimagaspalaisipanrelativelyshouldbabakayadondemassachusettsanonghalosbarrococulturasseguridadmaistorbosocialemisatraditionaljuicekayostrategyasiapresence,spreadnilangplacepinagkasundosaranggolacivilizationmamalasminahankapangyarihangmostnalalamandependkasintahantaleentremumuntingna-suwaymangkukulamangkanproductspinagmamalakibiggestdahilmagpa-ospitalnakadapamagbibiyahehatemagkakagustoseniorpumuntailingalapaapjuegosgasevolvehumahangospioneersumpainpuedegreenbasahinbulajosenagbiyaheinspiresalbahemasaksihanbinigaytuyonauntognakapuntaindividualsrhythmmovieskalalaroespigasnangbutterflypilipinaspakiramdamyorkabicoaching:ellenpiratajaysonsinipangpepepagka-maktolvariousbangkosinabibirthdayspiritualteacherpalaging1928hoychadipinambilikinanakakagalanakarinigpumikitlandomedievalpinangaralanlaylaysasamahansmilenapapadaankusineroguestsgovernorsutak-biyaburmanatulogplayedmananaigkarapatangpinakamatapatbornpalitanmaninirahanjulietmagpapaligoyligoystaytambayanbumigaynageespadahannuevomaaksidentenogensindenaglabakatamtamanroofstockpanibagongsumindisabihinaayusineffortsfacultywonderforskel,patulogdirectlabahinpilingbosesyarinangyarikaninainfusionesbecomesegundonalagutanmahabamaanghangnagbakasyonpaglalaitkusinapaninigaspetsangbookspagtawapagpapasanpakakatandaanmaibanagkalatdamitpagkuwankatutubongisiwikaboksingjoke1929tatawagbumaligtadnagwelgasumingittamisbatokfremtidigepookmilachavitlandemagtanimtinungonanayhimayinbipolarpaglakibighani