Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. They have organized a charity event.

2. Ang mapa ng mundo ay nagpapakita ng lahat ng mga bansa sa buong mundo.

3. Ibinigay ng aking mga kaibigan ang kanilang suporta at pagsuporta sa aking mga pangarap.

4. Sa gitna ng kagubatan, narinig ang hinagpis ng mga hayop na nawalan ng tirahan dahil sa pagtotroso.

5. It's important to maintain a good credit score for future financial opportunities.

6.

7. Gambling er en form for underholdning, hvor man satser penge på en chancebaseret begivenhed.

8. Humihingal na rin siya, humahagok.

9. Acts of kindness, no matter how small, contribute to a more charitable world.

10. Sa pagkakatumba ni Aya, nanlilisik pa ang mga matang tumingin sa ama.

11. Sinabi naman ni Apollo ang mga dapat gawin.

12. Inflation kann auch durch eine Verringerung des Angebots an Waren und Dienstleistungen verursacht werden.

13. Virksomheder i Danmark, der eksporterer varer, er afgørende for den danske økonomi.

14. Das Gewissen kann uns helfen, die Folgen unserer Handlungen besser zu verstehen.

15. She has been teaching English for five years.

16. Huwag kang pumasok sa klase!

17. Bagamat naghihirap ay alaga siya ng ama't ina sa masasarap na pagkain.

18. Nakatingala siya kay Ogor, mahigpit na kinukuyom ang mga palad.

19. Ipantalop mo ng kamote ang kutsilyo.

20. Si Carlos Yulo ang unang Filipino gymnast na nakakuha ng gintong medalya sa World Championships.

21. Tobacco was first discovered in America

22. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

23. Pasensya na, kailangan ko umalis ng maaga.

24. La pièce montée était absolument délicieuse.

25. El agua tiene propiedades únicas, como la capacidad de disolver sustancias y regular la temperatura.

26. Gracias por ser honesto/a y decirme la verdad.

27. Gusto kong malaman mo na may gusto ako sa iyo kahit na hindi ko ito masabi sa iyo nang personal.

28. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

29. Sus gritos están llamando la atención de todos.

30. Las hierbas como el jengibre y la cúrcuma tienen propiedades antiinflamatorias y antioxidantes.

31. Hindi niya gustong maging nag-iisa sa pagpaplano ng kanyang kinabukasan.

32. La tos seca es una tos que no produce esputo o flema.

33. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

34. Los héroes nos inspiran a ser mejores y nos muestran el poder de la bondad y el sacrificio.

35. Es importante ser honestos con nosotros mismos para tener una buena conciencia.

36. The bakery specializes in creating custom-designed cakes for special occasions.

37. Masaya ang pakanta-kantang si Maria.

38. Muchas personas utilizan las redes sociales para expresar sus opiniones y puntos de vista.

39. Supreme Court, is responsible for interpreting laws

40. Uh huh? medyo naguguluhan kong sabi.

41. Pinagtabuyan ng mga mababangis na hayop at ng mga ibon ang kawawang si Paniki.

42. Malinis na bansa ang bansang Hapon.

43. Matapang si Andres Bonifacio.

44. Ano ba pinagsasabi mo?

45. The reviews aren't always reliable, so take them with a grain of salt.

46. May anim na silya ang hapag-kainan namin.

47. Ito'y hugis-ulo ng tao at napapalibutan ng mata.

48. Pinakain ni Fia ang aso ng dog treats.

49. La labradora de mi vecina siempre ladra cuando alguien pasa por la calle.

50. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

Recent Searches

pagkabuhayfollowing,tig-bebentesasagutinnagsagawanakadapaopgaver,dumagundongnawalangpaglalaitaanhincultivakonsultasyonnananalonasasabihangawingnaglulutoarbejdsstyrkemagdamaganpilipinasnagsmilenasaktannalamanvillagemaipapautangnagsuottumalimpandidiripagkaraapagigingtumahanseguridadmakukulaytumunognakakamitnareklamonovellesnangangalitmasaksihanpakakatandaanpaki-chargenagdiretsotitamalapalasyopalancanagbantaynaiilaganstrategiestiktok,tatagalkalaunanhabilidadesuulamincualquiertaga-ochandofysik,magamotmasasabinagbabalabutikikapintasanghurtigerecompanyvidenskabmakapagempakere-reviewpagkaawakahongbowltabinghanapbuhaytargetmasyadongdistanciailalagaysalbahengnagdadasalkondisyonmagpasalamatpagsagotlalabhanyumuyukotv-showsprimerosnapakagandamagbibiladapatnapumagkabilangmatagumpayika-50pinabulaantsismosamagselosbahagyabayadinlovenanamangovernorssiyudadmagbabalapaanonglalabalumindolsilid-aralantherapeuticsnatanongmagkanonatinagmabagalpaulit-ulittumapospinauwipahabolnakapagproposekaliwatumigilmahuhulimakaiponpaosnatatawaalas-dospakilagaymatutongkonsyertonaglulusakalanganmadadalaeksport,makakamabigyandireksyonnobodyumokaysaktantiemposunanniyogsumasayawhinalungkatgagamitsarisaringnakisakayisasamana-curioussusunodbusiness:nagbibigayantienenmuntingsponsorships,mataraymaidtelefoncarbonmagbigayannagtatrabahohikingkaugnayanmatigasfatherpresleytinikkatagalanyeymaistorboninyopangkatantokathenadumilimmalapitanfarmtugontulalalipatself-defensebaryoallowedaaisshlunessaboglaranganbiyassmilegrowthtatlumpungguidanceawardbumabagilawnapaplastikanilocospaghabarosellebalangalaylipadpangingimiginaganoonpsss