Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

2. Tumayo siya tapos nagmadaling pumunta sa cr

3. Proses kelahiran di Indonesia umumnya dilakukan di rumah sakit atau pusat kesehatan masyarakat (Puskesmas).

4. Maaaring tumawag siya kay Tess.

5. Magkano ang tiket papuntang Calamba?

6. Det giver os mulighed for at udføre mange forskellige opgaver, fra simpel redigering af tekst til avancerede beregninger og simuleringer

7. Bata pa lang si Tony nang iwan sya ng kanyang ama

8. Matapos ng ilang araw ito ay namulaklak.

9. Inakyat ng bata ang puno at tinikman ang bunga.

10. Sa loob ng aking dibdib, nagliliyab ang poot na pilit kong iniipon.

11. Lumabas na rin naman ako pagkatapos.

12. spread information and knowledge from one corner of the globe to another.

13. Mababa ang tubig sa ilog dahil sa tag-init.

14. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

15. Sa hatinggabi, maraming establisimyento ang nagsasarado na.

16. The impact of the pandemic on mental health has been immeasurable.

17. Ang mahal pala ng ticket papuntang Amerika!

18. Tengo dolor de garganta. (I have a sore throat.)

19. Ilang tao ang nagpapaitim sa beach?

20. Limitations can be cultural or societal, such as gender roles or stereotypes.

21. Ang pagsunod sa regular na oras ng pagtulog ay mahalaga upang mapanatili ang maayos na gising.

22. El powerbank se carga conectándolo a una fuente de energía, como un enchufe o una computadora.

23. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

24. En helt kan være enhver, der hjælper andre og gør en positiv forskel.

25. Nationalism has been used to justify imperialism and expansionism.

26. Isang binata ang napadaan at tinangkang kumain ng bunga ng puno.

27. Advances in medicine have also had a significant impact on society

28. Gaano ka kadalas nag-eehersisyo?

29. Working in a supportive and positive environment can improve job satisfaction.

30. The early bird gets the worm, but don't forget that the second mouse gets the cheese.

31. Kucing di Indonesia juga terkenal dengan sifatnya yang suka tidur dan bermalas-malasan.

32. Landet er en af de mest velstående i verden, og dette kan tilskrives en række faktorer, herunder en høj grad af økonomisk vækst, en velfungerende arbejdsstyrke og en høj grad af offentlig velfærd

33. Hindi dapat magpabaya sa pag-aaral upang makamit ang mga pangarap.

34. Ang kanyang galit ay parang nagbabaga, handang sumiklab anumang oras.

35. Sa paaralan, mahigpit na ipinagbabawal ang anumang uri ng abuso laban sa mga mag-aaral.

36. Binilhan ni Fidel ng bulaklak si Imelda.

37. Tsss. aniya. Kumunot pa ulit yung noo niya.

38. The elderly are at a higher risk of developing pneumonia.

39. Nagdesisyon umano ang alkalde na ipagpaliban ang klase dahil sa masamang panahon.

40. Tumayo yung limang babae at lumapit kay Kerb.

41. Nahawa ako ng kuto sa kapatid ko.

42. The bank approved my credit application for a car loan.

43. Mi aspiración es trabajar en una organización sin fines de lucro para ayudar a las personas necesitadas. (My aspiration is to work for a non-profit organization to help those in need.)

44. Before a performance, actors often say "break a leg" to each other for good luck.

45. Napangiti na lang ako habang naka tingin ako sa kanya.

46. Kumain ka na ba? Tara samahan kitang kumain.

47. Ang yaman naman nila.

48. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

49. Kailangang magluto ng kanin ni Pedro.

50. Puwede ba siyang pumasok sa klase?

Recent Searches

following,nakaririmarimnagbibiroharapaninagawitinatapatnakabibingingkatolisismolumusobtelebisyonwhatsappregulering,pahabolanywherekamatisumingitasulclientsomeletteimpitrichna-curiouspinapakinggannalangdiferentesproducenangingilidandreamaibigaytiemposgalaanpaanoisabinabaanlackplayedgumuglongbairdlingidguhitupopancitabenekwebangwideearnsumusunosahodkasinggandacoloursincejamesgamewriting,whilesagotuloquicklybitbitmobilecontinueslandesinipangpagsalakaymanamis-namiskasakitumakyatmamalasinuulamseekincitamenterpagsubokpaglakinamulatyumaocharmingbranchesnakakagalapinaghatidanhinimas-himastanimkuligligsandwichhastambayansarabeingipongbumabafaultperasumaliwalletnalasingdaandedication,dogangkingfrogtablestoplighttechnologiesanimevilventasofaboxtumahimikaanhinpinahalatanauponagpaiyaknagtrabahomarketplacesextrapaligsahanpagguhitnaliligonasaanhinihintaythanksgivingnapasubsobmabaitmariaindividualskumbentosuwailcarollalakesocialebibilhinmakulityeshydelhumanosmaskmallfeedback,artswestdettedinanaspriestprutasmalihisnahihilowasteincidencekatapatmatapangquezonmakakakaintirangriegakuwartonangingisaylandassurveystindahanpakistanbayadpinansinnaabutanpagpilisalitapronounnagpagupitnapaiyakpodcasts,ginugunitanakapagreklamogayunpamannagpapaniwalapinagsikapannasasalinanmagtigiltinakasanmedicinenapasigawtatagalcancerdulongpuntarobinhoodtawananpagpasokplanning,shadesgloriasinisigrocerykatagangpatienceestatekenjingisi1960sgaanoeksportennilapitan