Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following,"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Saan-saan kayo pumunta noong summer?

2. Ang pangalan ng tatay ko ay Honesto.

3. Pasensya na, kailangan ko nang umalis.

4. The Watts Towers, a collection of unique and intricate sculptures, are a testament to the city's artistic expression.

5. Hinde ko dala yung cellphone ni Kenji eh.

6. Nakakapagpatibay ng buto ang calcium.

7. Halos wala na itong makain dahil sa lockdown.

8. Ano ba pinagsasabi mo! Baliw ka ba! Umalis ka nga!

9. Nilaos sila ng bata at dahil dito, mas lalong yumabang ang bata.

10. Tengo tos seca. (I have a dry cough.)

11. I am absolutely confident in my ability to succeed.

12. Humahaba rin ang kaniyang buhok.

13. Ayaw mong magkasakit? Kung gayon, dapat kang kumain ng masusustansyang pagkain.

14. Maraming Pinoy ang nagta-trabaho sa ibang bansa bilang OFW.

15. All these years, I have been working to make a positive impact on the world.

16. Masayang-masaya siguro ang lola mo, ano?

17. Napasuko niya si Ogor! Napatingala siya Abut-abot ang pahingal.

18. Samantala sa trabaho, patuloy siyang nagpapakasipag at nagsusumikap para sa kanyang pamilya.

19. Salud por eso.

20. Napakababa ng respeto ko sa mga taong laging mangiyak-ngiyak para lang mapansin.

21. Elektronikken i et hjem kan hjælpe med at forbedre komfort og livskvalitet.

22. Comer saludable es una forma importante de cuidar tu cuerpo y mejorar tu calidad de vida.

23. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

24. Sa lugar na ito, naglipana ang mga prutas na hindi pangkaraniwan sa ibang lugar.

25. Close kasi kayo ni Lory. ngumiti sya na sobrang saya.

26. Akma siyang tatayo upang humingi ng tulong ng bigla siyang nalugmok sa kanyang kinauupuan.

27. Foreclosed properties may be sold with special financing options, such as low down payments or low interest rates.

28. Les personnes âgées peuvent faire face à la fin de leur vie avec courage et dignité.

29. Ok lang.. iintayin na lang kita.

30. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

31. Facebook Events feature allows users to create, share, and RSVP to events.

32. Anak natin. nakangiti pang sabi niya.

33. She missed several days of work due to pneumonia and needed to rest at home.

34. Dalam Islam, kelahiran bayi yang baru lahir diiringi dengan adzan dan takbir sebagai bentuk syukur kepada Allah SWT.

35. Wala kang sapat na pera para sa bakasyon? Kung gayon, ipagpaliban mo muna ito.

36. Mamimili si Aling Marta.

37. There are a lot of opportunities to learn and grow in life.

38. The candidate who wins the most electoral votes becomes the President

39. May kahilingan ka ba?

40. Cutting corners on food safety regulations can put people's health at risk.

41. The rise of digital currencies and payment systems is changing the way people use and think about money.

42. A lot of time and effort went into planning the party.

43. Einstein's legacy continues to inspire and influence scientific research today.

44. Ang mabangong lotion ay nagbibigay ng pag-aalaga sa balat at magandang amoy.

45. Ang kalayaan ay hindi dapat magdulot ng pang-aabuso sa kapwa.

46. The relationship between work and mental health is complex and can vary from person to person.

47. Dumating na sila galing sa Australia.

48. Nandoon lamang pala si Maria sa library.

49. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

50. Ang laki nang mga gusali sa maynila!

Recent Searches

following,maulitreviewersresearchabundanteoffentligviewsearchmakahingicreatebuwenasmatsingmabibingipapapuntapagdudugomananagotfreeculturetumakbotinungoibinaonmasyadonowpalagipaanongweddingmaalwangconsistnababasapapaanomagkamalimasarappasensyapagraranaskaninomagkapatidyatakahitpinamalagihumahabamagpakasalkapasyahansawagawingovernmentbetatinanongmainitkasamaanincreasemakukulaycosechasmanggagalingsinisirevolucionadolisensyapasyalannapansingroceryknowledgenagkantahannakaakyatjosefaupuanpaki-chargehindefionabingipasyaatensyonggoinggubatanongmariejoseloobmaliitbinatangnaglokonagtatrabahonabiawanglolaikinasasabikconsideredbusykatabingpambatangna-suwayanyousureroapoysyabaulbobpahiramnakapangasawaamerikanagtrabahosalamangkerofestivalesmangyarikandoyoktubrerepublicantulisanmadurasnakataasakmangtiyapakikipaglabannakangisinakuhangvidenskabadvertisingfirstsarapinakamaartengpepeyounghumigamatapangwerelandeiskedyullayuancapitalpatiencemaipagmamalakingfeeltalinopiyanopansamantalaabitabiagostoentertainmentsumpadesign,crossiphonelargoalbularyodumiretsoniyaandoypantheonpapuntamalalimitinuturingjejumakikiligodisciplinlarrymeanpeppyalagahigitniyogricolarawansumusunodbumabamagbayadsakimmasaksihanpagsahodtodaykirotnagliliwanagsukatininfluentialpataynakapagproposenanlilimahidbobotocollectionsbataymalapitmagpa-picturenagtakaaddictionnaglutotatayomagbigayannagmadalinghojasimpactedstatingpagkatmagselosnothingsamutshirts-sorrynagtutulunganahittumamisnagplayelectedkumakain