Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

35 sentences found for "long"

1. A wife's love and devotion can provide a stable foundation for a long-lasting marriage.

2. Accomplishing a long-term goal can create a sense of euphoria and relief.

3. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

4. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

5. Cheating can occur in both short-term and long-term relationships, and can affect couples of any age, race, or sexual orientation.

6. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

7. Einstein's ideas challenged long-held assumptions about the nature of space and time.

8. Environmental protection requires a long-term vision and commitment to future generations.

9. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

10. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

11. Investing can be a long-term strategy for building wealth and achieving financial goals.

12. Investing requires discipline, patience, and a long-term perspective, and can be a powerful tool for achieving financial goals over time.

13. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

14. Jeg har været forelsket i ham i lang tid. (I've been in love with him for a long time.)

15. Les habitudes de vie saines peuvent aider à prévenir les maladies et à maintenir une bonne santé tout au long de la vie.

16. Les objectifs à long terme peuvent sembler écrasants, mais la division en tâches plus petites et plus gérables peut aider à maintenir la motivation.

17. Leukemia can be cured in some cases, but long-term monitoring is necessary to prevent relapse.

18. Make a long story short

19. Mathematics has a long history and has contributed to many important discoveries and inventions.

20. May mga pagkakataon na kinakailangan mong hiramin ang isang sasakyan para sa long-distance travel.

21. Nakatira si Nerissa sa Long Island.

22. Rapunzel is a girl with long, magical hair who is locked in a tower until a prince comes to her rescue.

23. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

24. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

25. Television has a long history, with the first television broadcasts dating back to the 1920s

26. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

27. The stock market can be used as a tool for generating wealth and creating long-term financial security.

28. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

29. The Tesla Supercharger network provides fast charging infrastructure for Tesla owners, allowing them to travel long distances with ease.

30. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

31. The United States has a long-standing relationship with many countries around the world, including allies such as Canada and the United Kingdom.

32. We were stuck in traffic for so long that we missed the beginning of the concert.

33. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

34. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

35. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Gusto mo bang sumama.

2. Tsong, hindi ako bingi, wag kang sumigaw.

3. Ang mga sundalo nagsisilbi sa kanilang bansa upang protektahan ang kanilang kalayaan.

4. The pursuit of money can have both positive and negative effects on people's lives and relationships.

5. Sa loob ng paaralan, ang ingay ng mga mag-aaral ay binulabog ang kasiyahan ng mga guro.

6. Les hôpitaux sont des lieux où les patients peuvent recevoir des soins spécialisés.

7. Das Gewissen kann uns helfen, die Folgen unserer Handlungen besser zu verstehen.

8. Inilabas ng pulisya ang larawan ng salarin upang matulungan ang mga sibilyan na makakilala sa kanya.

9. Ang pagguhit ay isang mahusay na paraan upang ipakita ang iyong kreatibidad.

10. Les travailleurs peuvent changer de carrière à tout moment de leur vie.

11. Mababa ang kalidad ng produkto kaya hindi ito nagtagal sa merkado.

12. Walang sinumang nakakaalam, sagot ng matanda.

13. Naglaro sa palaruan ang mga bata nang limahan.

14. I do not drink coffee.

15. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

16. Nagsusulat ako ng mga pangako sa aking mga minamahal sa mga espesyal na okasyon.

17. Ang Ibong Adarna ay nagpapakita ng mahalagang papel ng musika at pag-awit sa kwento nito.

18. Les écoles offrent des programmes d'apprentissage des langues pour les étudiants.

19. Los agricultores a menudo enfrentan desafíos como sequías, inundaciones y plagas.

20. Uncertainty can create opportunities for growth and development.

21. Masaya ako tuwing umuulan at kapiling ka.

22. El arte puede ser utilizado para transmitir emociones y mensajes.

23. Sana, binigyan mo siya ng bulaklak.

24. Tolong jangan lakukan itu. - Please don't do that.

25. The value of cryptocurrency can fluctuate rapidly due to market forces.

26. La serpiente marina es una especie adaptada a la vida acuática y es una de las serpientes más venenosas del mundo.

27. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

28. The chef is not cooking in the restaurant kitchen tonight.

29. Hindi siya naging maramot nang magbigay ng kanyang oras para tumulong sa proyekto.

30. The judicial branch, represented by the US

31. At være transkønnet kan påvirke en persons mentale sundhed og kan føre til depression, angst og andre psykiske udfordringer.

32. Oscilloscopes can measure not only voltage waveforms but also current, frequency, phase, and other parameters.

33. Si Hidilyn Diaz ay naging inspirasyon din sa iba’t ibang mga atleta sa buong mundo.

34. Trump's rhetoric and communication style were often unconventional and garnered both passionate support and strong opposition.

35. He is painting a picture.

36. Naglalaway ang mga manonood habang pinapakita sa TV ang masarap na pagkain.

37. Kapag bukas palad ka sa iyong mga pangarap, mas madali itong makamit dahil hindi ka nagtatago sa mga taong pwedeng magbigay ng tulong.

38. Siya ay mayabang at masyadong malaki ang pagkakilala sa sarili

39. Natagpuan niya ang singsing matapos niyang salatin ang ilalim ng sofa.

40. Nagpagupit ako sa Eclipxe Salon.

41. Nagtatanim ako ng mga flowering plants upang magkaroon ng magandang tanawin sa paligid.

42. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

43. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

44. Ang pagbibigay ng alay sa mga diwata ng kalikasan ay isang mahalagang ritwal sa kanilang kultura.

45. Sa takip-silim, maaaring mas mapakalma ang mga tao dahil sa kulay at hangin na mas malumanay.

46. They are not building a sandcastle on the beach this summer.

47. He bought a series of books by his favorite author, eagerly reading each one.

48. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

49. Reinforcement learning is a type of AI algorithm that learns through trial and error and receives feedback based on its actions.

50. El paisaje que rodea la playa es sublime, con sus aguas cristalinas y suave arena.

Similar Words

tatlongpulongpantalongnagpatulongtulongPinapagulongkilongmakatulongikawalongwalongtumulongbulongpabulongmakakatulongbinulonggumulongKalongulongnakasilongmakasilonglalongilongibinubulonggumuglongnakatulongnananalongnakakulongpagkakakulongnakakatulongkatulongikatlongnatalongmakulongalong

Recent Searches

longsarilinghacerkaysangbuwislasananaisinmalalimpadreimpactderpampagandapaguutoskubyertossiponmasayang-masayangpakanta-kantagrahamnalagutanwariayawpagguhitkinainpriestipaghandanaminiyakpag-unladtiniradornatindoktorhinabiaccessatentoownstateskayalabissmokernotkinikilalanggreenhillspabalangtamagamititoditomumuntingaraw-arawfanspanghihiyangkuripotbangstudynamumuomariasucht-ibangsultanjudicialdahilriskibinentamatikmanshiningnaniniwalahasnagkaroongumagamitusenapagkindergartenguiltynoonkaramihanpagsubokpinag-usapanpagsusulathimutokworryisiptakotmaskiactingnagpupuntamaskaramabuticonditioningmungkahisimbahancharitablenagkakakainpagtitiponsinapakcover,nabuhaynahawakannegativekakilalamismoagadbukashanggangbakaldalandanipagtatapatnapakagandatrademaaaringpinilitmarahilsumaliwbakaanihinpuliskasaysayanwakasmapagkalingamakapangyarihanlupainanobarkogawingawainlikasfacekasiyahangapelyidolupadiyosangsilaresignationnecesitapoliticspuwedesinulidhabangkusinerolaryngitisnaglahopag-itimhamontinderakangvelfungerendebinibinihinalungkatmanamis-namisnangahasmaputiimportantecomunesutusankainacademyatamangahasdeterminasyongayundinsinalansanmaaarihongnagmasid-masidmahiligpagsalakaysumapitibonchambersnapakaramingtomweddingtaoinangatkesonangyayaripanginoonsinunggabanmagandamanytinapayamazonpettigrelumiwagnicomarurumigirlworldpaperboardtuwidbansangsinunud-ssunodrelevantkaalamanmaunawaanklasengsopaspool