Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

35 sentences found for "long"

1. A wife's love and devotion can provide a stable foundation for a long-lasting marriage.

2. Accomplishing a long-term goal can create a sense of euphoria and relief.

3. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

4. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

5. Cheating can occur in both short-term and long-term relationships, and can affect couples of any age, race, or sexual orientation.

6. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

7. Einstein's ideas challenged long-held assumptions about the nature of space and time.

8. Environmental protection requires a long-term vision and commitment to future generations.

9. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

10. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

11. Investing can be a long-term strategy for building wealth and achieving financial goals.

12. Investing requires discipline, patience, and a long-term perspective, and can be a powerful tool for achieving financial goals over time.

13. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

14. Jeg har været forelsket i ham i lang tid. (I've been in love with him for a long time.)

15. Les habitudes de vie saines peuvent aider à prévenir les maladies et à maintenir une bonne santé tout au long de la vie.

16. Les objectifs à long terme peuvent sembler écrasants, mais la division en tâches plus petites et plus gérables peut aider à maintenir la motivation.

17. Leukemia can be cured in some cases, but long-term monitoring is necessary to prevent relapse.

18. Make a long story short

19. Mathematics has a long history and has contributed to many important discoveries and inventions.

20. May mga pagkakataon na kinakailangan mong hiramin ang isang sasakyan para sa long-distance travel.

21. Nakatira si Nerissa sa Long Island.

22. Rapunzel is a girl with long, magical hair who is locked in a tower until a prince comes to her rescue.

23. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

24. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

25. Television has a long history, with the first television broadcasts dating back to the 1920s

26. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

27. The stock market can be used as a tool for generating wealth and creating long-term financial security.

28. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

29. The Tesla Supercharger network provides fast charging infrastructure for Tesla owners, allowing them to travel long distances with ease.

30. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

31. The United States has a long-standing relationship with many countries around the world, including allies such as Canada and the United Kingdom.

32. We were stuck in traffic for so long that we missed the beginning of the concert.

33. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

34. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

35. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Many wives have to juggle multiple responsibilities, including work, childcare, and household chores.

2. The love that a mother has for her child is immeasurable.

3. Kabilang na dito ang pamilya ni Mang Pedro at Aling Rosa at ang nag-iisa nilang anak na si Ana na siyam taong gulang.

4. Si Mang Ernan naman na isang manunulat, isa ring propesor sa isang unibersidad sa maynilaat nagging kasapirin sa iba't ibang samahan

5. Kailan niyo naman balak magpakasal?

6. Ang pagkikita at pag-uusap sa isang propesyonal na tagapayo o therapist ay nakagagamot sa aking emosyonal na kalagayan.

7. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

8. Después de la tormenta, el cielo se vuelve más oscuro y las nubes se alejan.

9. Pinili niyang magtungo palayo sa gulo upang makahanap ng katahimikan.

10. Frohe Weihnachten! - Merry Christmas!

11. Napakabuti ng doktor at hindi na ito nagpabayad sa konsultasyon.

12. Labis kang nasugatan, mabuti pa siguro ay sumama ka sa akin upang magamot ng aking asawa ang iyong mga sugat.

13. Nasa Montreal ako tuwing Enero.

14. Maaaring magkaroon ng interest at late fees kapag hindi nabayaran ang utang sa tamang panahon.

15. Ang nababakas niya'y paghanga.

16. Have we missed the deadline?

17. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

18. Hindi maganda ang amoy ng damit kung hindi ito maayos na naglalaba.

19. Sige ako na ang isa pang sinungaling! Bwahahahahaha

20. La labradora de mi colega es muy sociable y siempre se lleva bien con otros perros.

21. Ang pagmamalabis sa pag-inom ng alak ay maaaring magdulot ng mga problemang pangkalusugan at personal.

22. Ang masamang balita ay unti-unting naghatid ng kanyang damdamin palayo sa kasiyahan.

23. Habang naglalakad sa park, pinagmamasdan niya ang mga puno na sumasayaw sa hangin.

24. Hinintay lamang niya ang aking pagdating.

25. Money can be earned through various means, such as working, investing, and entrepreneurship.

26. Sa sobrang pagod, nagawa niyang paglimot sa mga pangyayari ng nakaraang araw.

27. The level of sweetness can vary in different types of sugar and sweeteners.

28. La desigualdad económica y social contribuye a la pobreza de las personas.

29. Si Rizal ay kilala rin sa kanyang pagmamahal sa kanyang bansa at sa kanyang mga kababayan.

30. Es importante ser conscientes de nuestras acciones y cómo pueden afectar a los demás.

31. Si Hidilyn Diaz ay naging inspirasyon din sa iba’t ibang mga atleta sa buong mundo.

32. Hindi naman siya masyadong maarte pero ayaw niya ng mga gusot sa kanyang mga damit.

33. Mahilig sa paglilinis si Susan kaya't hindi siya nag-aalala kapag kailangan niyang maglaba ng malalaking bagay.

34. Cancer can impact not only the individual but also their families and caregivers.

35. The weather was bad, and therefore the game was cancelled.

36. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

37. The executive branch, represented by the President of the United States, is responsible for enforcing laws

38. Kabilang na roon sina Lala, Dada at Sasa.

39. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

40. Ibinigay niya ang kanyang pag-ibig at suporta sa gitna ng mga pagsubok.

41. Ang kanilang panaghoy ay tinugunan ng tulong mula sa mga taong may mabubuting puso.

42. Kailangan nating magbigay ng halaga sa mga kababawang bagay upang mag-enjoy sa buhay, pero hindi dapat ito maging priority.

43. Ang mga pangarap natin ay nagtutulak sa atin upang magkaroon ng mga positibong pagbabago sa buhay.

44. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

45. Mabilis nyang kinuha ang laptop upang tapusin ang kanyang nobela.

46. Tomar decisiones basadas en nuestra conciencia puede ser difícil, pero a menudo es la mejor opción.

47. Pinoy pride ang dala ng mga atleta natin sa bawat laban.

48. He starred in a number of films in the 1950s and 1960s, including Love Me Tender, Jailhouse Rock and Viva Las Vegas

49. Tantangan hidup memberikan kesempatan untuk memperluas kemampuan dan meningkatkan kepercayaan diri.

50. En algunas regiones, el invierno puede ser muy frío y peligroso para la salud si no se toman las precauciones adecuadas.

Similar Words

tatlongpulongpantalongnagpatulongtulongPinapagulongkilongmakatulongikawalongwalongtumulongbulongpabulongmakakatulongbinulonggumulongKalongulongnakasilongmakasilonglalongilongibinubulonggumuglongnakatulongnananalongnakakulongpagkakakulongnakakatulongkatulongikatlongnatalongmakulongalong

Recent Searches

natinlongsagotmariaanak-mahirapmungkahikanyabarangaymaaliwalascelularespamilyahamonbulakalakminutenalalabihalamanankomunidadpunsoimportanteoperahankikitabularinpangarapperopaungolhubad-baromagandamatatalimkahirapanmetrolibroginamitvitaminnahintakutankinamumuhianmagalitsisikatnangampanyadiplomamaratinglumbaymamayaanlabomuchaheimayamangmamanuganginglaybrarisimplengbantulothihigitasaganapnatayoilawospitaldagokkarununganmapapapag-asalitsonpaglisanisa-isanagitlayunglilipadsahodmaghugasdustpanbangaayudatalinopanitikan,reallymatatandasiyangtanganmaputlapakibigayjingjinghoncuandoamendmentpakpaksementeryopag-uugalimagkasamajokefieldhigawalisnanlilisikbinilhanulanmarangaltwo-partyonlinedalawinpatuloylarawanednahumihingalmatalinoyanparticipatingmalusogjeepneybatalanmagitingtagaisuboskillsmadungislandslidemagdalaeffectpangangailanganambasolarpleaseforcesharmfulrecibirhasi-googlelandodisensyowords00amcomputerstumatanglawmatalimpinangalanangbuhokpakealammababasag-ulonakapagreklamoafternakakaenwalangkapalledmalinisnatutuwanagsagawabasedalamsystemtakemartialnagwo-workmaya-mayamalapitnaturalwereapelyidoreservesnoonagsibilitaga-ochandonatulogkahoykalagayanTamadmasakitoverallhomeworkabotnakatanggapnagtagisanpagnanasaifugaomagsisinebayanikumbentolabananstartelijetumalikodibonsaanalaspanginoonulocompleteeducationalbarabasarbejdsstyrkealaalapag-aalalapalayanayawmamataansampaguitaitemspakanta-kantabarung-barongkalarobulong