Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

35 sentences found for "long"

1. A wife's love and devotion can provide a stable foundation for a long-lasting marriage.

2. Accomplishing a long-term goal can create a sense of euphoria and relief.

3. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

4. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

5. Cheating can occur in both short-term and long-term relationships, and can affect couples of any age, race, or sexual orientation.

6. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

7. Einstein's ideas challenged long-held assumptions about the nature of space and time.

8. Environmental protection requires a long-term vision and commitment to future generations.

9. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

10. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

11. Investing can be a long-term strategy for building wealth and achieving financial goals.

12. Investing requires discipline, patience, and a long-term perspective, and can be a powerful tool for achieving financial goals over time.

13. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

14. Jeg har været forelsket i ham i lang tid. (I've been in love with him for a long time.)

15. Les habitudes de vie saines peuvent aider à prévenir les maladies et à maintenir une bonne santé tout au long de la vie.

16. Les objectifs à long terme peuvent sembler écrasants, mais la division en tâches plus petites et plus gérables peut aider à maintenir la motivation.

17. Leukemia can be cured in some cases, but long-term monitoring is necessary to prevent relapse.

18. Make a long story short

19. Mathematics has a long history and has contributed to many important discoveries and inventions.

20. May mga pagkakataon na kinakailangan mong hiramin ang isang sasakyan para sa long-distance travel.

21. Nakatira si Nerissa sa Long Island.

22. Rapunzel is a girl with long, magical hair who is locked in a tower until a prince comes to her rescue.

23. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

24. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

25. Television has a long history, with the first television broadcasts dating back to the 1920s

26. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

27. The stock market can be used as a tool for generating wealth and creating long-term financial security.

28. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

29. The Tesla Supercharger network provides fast charging infrastructure for Tesla owners, allowing them to travel long distances with ease.

30. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

31. The United States has a long-standing relationship with many countries around the world, including allies such as Canada and the United Kingdom.

32. We were stuck in traffic for so long that we missed the beginning of the concert.

33. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

34. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

35. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

2. Balak po naming bumalik sa susunod na linggo.

3. Mahilig sa paglilinis si Susan kaya't hindi siya nag-aalala kapag kailangan niyang maglaba ng malalaking bagay.

4. Argh. Parang batang bading naman eh. Anubayan.

5. Tila nagbago ang ihip ng hangin matapos ang kanilang pag-uusap.

6. I finally quit smoking after 30 years - better late than never.

7. Kahit hindi siya lumingon, para na niyang nakita si Ogor.

8. Paki-charge sa credit card ko.

9. Naririnig ko ang malakas na tunog ng ulan habang ako ay tulala sa bintana.

10. Ang mga estudyante ay bumalik na sa kanilang mga dormitoryo sa hatinggabi.

11. Bawal magpakalat ng mga labis na pamahiin dahil ito ay nagdudulot ng takot at kawalan ng kaalaman.

12. Nagmungkahi ang dentista na ipalinis ko na ang aking ngipin.

13. Nagpapasalamat ako sa aking mga magulang dahil sa kanilang bukas palad na pagtanggap sa akin kahit anong desisyon ko sa buhay.

14. Pwede ba ako makahiram ng sapatos?

15. Ang malalakas na hagupit ng hangin sa gitna ng bagyo ay binulabog ang mga puno at nagdulot ng pagkasira sa mga istraktura.

16. Si Marian ay isang sikat na artista sa Pilipinas.

17. Nanalo si Lito sa pagka gobernador ng kanilang lugar.

18. Ang mga kasal ay karaniwang nagaganap sa mga simbahan, katedral, o sa mga magagarang venue.

19. Hindi ako sang-ayon sa mga komento na narinig ko tungkol sa iyo.

20. Nangangako akong pakakasalan kita.

21. Kasalukuyan siyang nagtitiis sa init nang may maulinigan siyang siga mula sa tindahan.

22. Medarbejdere skal ofte undergå årlig evaluering af deres præstation.

23. Sa bawat pagkakataon, dapat nating ipaglaban at ipagtagumpay ang ating kalayaan.

24. Ayos lang yun. May nagsabay naman sa akin eh. sabi ko.

25. El internet ha hecho posible la creación y distribución de contenido en línea, como películas, música y libros.

26. La visualisation et la réflexion sur ses réussites passées peuvent également aider à maintenir la motivation.

27. Ang pagtanggi sa mga paniniwala at opinyon na hindi pabor sa sarili ay nagpapakita ng pagiging bulag sa katotohanan.

28. Emphasis can be used to provide clarity and direction in writing.

29. Nagagandahan ako kay Anna.

30. Ang kasal ay isa sa pinakamahalagang okasyon sa buhay ng isang tao.

31. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

32. Ang Biyernes Santo ay pagluluksa.

33. Nanonood nga muna ito at saka lang bumaba sa nananalong grupo.

34. Mabait ang mga kapitbahay niya.

35. Nagsmile siya sa akin at ipinikit niya ulit yung mata niya.

36. Human trafficking is a grave crime that needs immediate action worldwide.

37. Medyo kakaiba ang pusang ito sapagkat makapal ang kulay dalandan na balahibo.

38. Omelettes are a popular choice for those following a low-carb or high-protein diet.

39. Siya ay kilala sa kanyang abilidad sa pagsusulat ng mga makabuluhang tula.

40. Nagbabaga ang pakiramdam ng kanyang balat dahil sa matagal na pagkabilad sa araw.

41. Maarte siya sa kanyang pagpili ng libro kaya halos lahat ng kanyang binabasa ay mga klasikong nobela.

42. Ok lang.. iintayin na lang kita.

43. The experience of bungee jumping was both terrifying and euphoric.

44. Maraming tao ang nagpapanggap na bukas palad upang makuha ang gusto nila, kaya kailangan nating maging maingat.

45. The culprit behind the vandalism was eventually caught and held accountable for their actions.

46. Hindi natin kara-karaka madadala ito nang walang ebidensya.

47. Sa loob ng sinehan, nabigla siya sa biglang pagsabog ng surround sound system.

48. Para cosechar las almendras, primero se deben sacudir los árboles con cuidado.

49. Ang takip-silim ay isang magandang panahon para sa mga nagmamahalan at naglalakad sa ilalim ng mga ilaw ng poste.

50. He does not argue with his colleagues.

Similar Words

tatlongpulongpantalongnagpatulongtulongPinapagulongkilongmakatulongikawalongwalongtumulongbulongpabulongmakakatulongbinulonggumulongKalongulongnakasilongmakasilonglalongilongibinubulonggumuglongnakatulongnananalongnakakulongpagkakakulongnakakatulongkatulongikatlongnatalongmakulongalong

Recent Searches

longvasquesareatuwidmatabaartificialnilaipinalitincludemediummessageroquewebsiteinilingflynovellesdeterminasyontatagalkendipulgadaeksamkikitapresidentegovernmentmagtipidagam-agampatunayanhomespalantandaansagasaannamataytravelnakakarinigtinutopnagpakunotdagatpakpaktamaanlaranganbumuhossumimangotcalidadprosesokayokaybilisawaretumalimyakapinmagkasamakwartotumahanproductividadnaapektuhanstructuremaghaponnasaannapakabilisre-reviewpakinabanganumagawumiimikmuchastakesentermabutitenerfriendbagalmaayospakisabicareerinventadoampliatumingalaiinuminkaarawantumabahumalovideosnagsmileo-onlinekinalilibingantumiratotoonglumiwanagnagsisigawkaaya-ayangkasalukuyannaninirahanmatagpuannalagutankumaliwainilalabasnananalounahinkagandahannagkasunogpalasyovedvarendediferentesnapilipaligsahanmahabangnaglaoneranyoutubepinagsulataabsentmabibinginangingisaynauntogattorneymakisuyonagpasamamagpakaramigloriaagostokatagangandreamahigitherramientasmaligayapigingbangkoasiaticinvitationkatagalancaroltibigassociationbesthvernageenglishdisposaljobsbecamenaniniwalakaninoexpertgagawinibigmalapadsubalitsyapalaybutihingkabosesalamcigarettesjustfridaybuwalknownwowipanlinisannainternalgenerationsnating1982sedentaryobstaclesmatagal-tagalmaramisuotkinabukasanpag-aapuhaptabinakapikitopisinaadventdinluisinalokinspiredwalletdedication,itinuturingsamesubject,bituincomplexprogramming,ableactoramericahojasrecibirnahulogbukodnagagandahanpagtuturoguhittabinghaloshateprotestabungangvaccineslakad