Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

35 sentences found for "long"

1. A wife's love and devotion can provide a stable foundation for a long-lasting marriage.

2. Accomplishing a long-term goal can create a sense of euphoria and relief.

3. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

4. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

5. Cheating can occur in both short-term and long-term relationships, and can affect couples of any age, race, or sexual orientation.

6. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

7. Einstein's ideas challenged long-held assumptions about the nature of space and time.

8. Environmental protection requires a long-term vision and commitment to future generations.

9. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

10. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

11. Investing can be a long-term strategy for building wealth and achieving financial goals.

12. Investing requires discipline, patience, and a long-term perspective, and can be a powerful tool for achieving financial goals over time.

13. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

14. Jeg har været forelsket i ham i lang tid. (I've been in love with him for a long time.)

15. Les habitudes de vie saines peuvent aider à prévenir les maladies et à maintenir une bonne santé tout au long de la vie.

16. Les objectifs à long terme peuvent sembler écrasants, mais la division en tâches plus petites et plus gérables peut aider à maintenir la motivation.

17. Leukemia can be cured in some cases, but long-term monitoring is necessary to prevent relapse.

18. Make a long story short

19. Mathematics has a long history and has contributed to many important discoveries and inventions.

20. May mga pagkakataon na kinakailangan mong hiramin ang isang sasakyan para sa long-distance travel.

21. Nakatira si Nerissa sa Long Island.

22. Rapunzel is a girl with long, magical hair who is locked in a tower until a prince comes to her rescue.

23. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

24. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

25. Television has a long history, with the first television broadcasts dating back to the 1920s

26. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

27. The stock market can be used as a tool for generating wealth and creating long-term financial security.

28. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

29. The Tesla Supercharger network provides fast charging infrastructure for Tesla owners, allowing them to travel long distances with ease.

30. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

31. The United States has a long-standing relationship with many countries around the world, including allies such as Canada and the United Kingdom.

32. We were stuck in traffic for so long that we missed the beginning of the concert.

33. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

34. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

35. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Ang agila ang pambansang ibon ng Pilipinas.

2. It's important to remember that April Fool's jokes should always be in good fun - nobody likes a prank that's mean or hurtful.

3. Magdamag na bukas ang ilaw sa kwarto.

4. Marami ang nahuhumaling sa larong mobile legends.

5. Ang daming kuto ng batang yon.

6. Emphasis can be used to persuade and influence others.

7. Pinaplano ko na ang aking mga gagawing sorpresa para sa aking nililigawan sa darating na Valentine's Day.

8. Inflation kann auch durch eine Erhöhung der Nachfrage nach bestimmten Waren und Dienstleistungen verursacht werden.

9. Mula sa tuktok ng bundok, natatanaw ko ang magandang tanawin ng kapatagan.

10. The film director produced a series of short films, experimenting with different styles and genres.

11. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

12. Nag-reply na ako sa email mo sakin.

13. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

14. Boboto ako sa darating na halalan.

15. La visualisation et la réflexion sur ses réussites passées peuvent également aider à maintenir la motivation.

16. Ang mga kasiyahan at salu-salo sa hapag-kainan ay nagdudulot ng kasiyahan sa bawat tahanan tuwing Chinese New Year.

17. The Lakers continue to be a dominant force in the NBA, with a dedicated fan base and a commitment to excellence on and off the court.

18. Huwag daw siyang makikipagbabag.

19. Hindi namin mahanap ang tarangkahan ng bahay mo kaya't nag-text kami sa iyo.

20. Sa kanyang pagbabasa ng libro, biglang napadungaw ang kanyang mata sa isang nakakatuwang larawan.

21. Patuloy ang labanan buong araw.

22. La tos puede ser un síntoma de COVID-19.

23. Einmal ist keinmal.

24. La falta de recursos económicos hace que sea difícil para las personas pobres salir adelante.

25. Saan na po kayo nagtatrabaho ngayon?

26. Mathematics can be used to model real-world situations and make predictions.

27. Pinayuhan sila ng albularyo na magdasal bago mag-umpisa ang gamutan.

28. Nagsine kami kamakalawa ng hapon.

29. Hun er utrolig smuk. (She is incredibly beautiful.)

30. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

31. Parang itinulos sa pagkakatayo ang mag-asawa at di malaman ang gagawin.

32. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

33. The task of organizing the event was quite hefty, but we managed to pull it off.

34. Magkano ang halaga ng bawat isang blusa?

35. Ang mga salitang mapusok ng kundiman ay naglalarawan ng pagnanasa at pagsisigaw ng pusong umiibig.

36. Ang tag-ulan ay nagdadala ng mga pagsubok sa mga nag-aaral dahil sa pagkansela ng klase dahil sa malakas na ulan.

37. ¿Cuánto cuesta esto?

38. Cheating is not always intentional and can sometimes occur due to a lack of communication or understanding between partners.

39. At have håb om, at tingene vil ordne sig, kan hjælpe os med at se lyset i slutningen af tunnelen.

40. Bilang isang Kristiyano, nagbibigay ng kahalagahan sa aking buhay ang mga awiting Bukas Palad.

41. Naging inspirasyon si Mabini para sa maraming Pilipino na maglingkod sa bayan.

42. Ang bansa ay dapat lagi nating isipin, hindi lamang ang ating sariling interes.

43. Kailan nagtapos ng kolehiyo si Peter?

44. Musk's companies have been recognized for their innovation and sustainability efforts.

45. Ngunit naglahong parang bula si Pinang.

46. Sa loob ng maraming taon, pinaunlad niya ang kanyang abilidad sa pagsasalita ng iba't ibang wika.

47. Nagpunta sa kumbento si Sister Jane.

48. Umutang siya dahil wala siyang pera.

49. Bumili si Ana ng regalo para diyan.

50. Tinuro nya yung box ng happy meal.

Similar Words

tatlongpulongpantalongnagpatulongtulongPinapagulongkilongmakatulongikawalongwalongtumulongbulongpabulongmakakatulongbinulonggumulongKalongulongnakasilongmakasilonglalongilongibinubulonggumuglongnakatulongnananalongnakakulongpagkakakulongnakakatulongkatulongikatlongnatalongmakulongalong

Recent Searches

longpasswordalebundokdirectamultinawagtinanggaprightstagtuyotsakennag-aasikasoyatamaalwangpaakyatnapilipagka-datusarongmasaksihanitsurakasalpangilmalimitganoontataytawagkomunidadcreativebungadmagpaniwalanangampanyatanyaganywheretumambadpawisguidebibilhintenderagricultoresbakunahouseholdspaglaki1787mangkukulamnaupomaghaponmedya-agwapinakamaartengnag-oorasyonsundhedspleje,nakukuhainsidentepaghalakhakpaga-alalanagtungodadanagtitindanakikilalangpagpapatuboinspirasyonpagkaimpaktofollowing,iintayinnakahigangmiyerkolesluluwaskinagalitankapatawarankikitadesisyonanmakauwipoorernagagamitpagkainistumiranalakitangekspioneerpagtataasaktibistapambahaypagkasabibestfriendhampaslupamagkaibangisasabadhandaitopagtatanghalnatabunanbumaligtadkatolisismokakutisnagbibiromarasiganumiimikmusicaleskaramihanmaramingapatiyamotkargahansiopaobihirangnagdalasinoseryosonganumangkangitanbutimaligayasahigbankbirthdaydesign,wakasbutterflychristmascuriousbilanginmatamanforståmatayogcareerpa-dayagonaldiseasesgigisingsmilesilakainanbantulotligaliglaganapnatigilandiligindakilangmasukolkamposalatindespuesbarangaytagakbesesmariemaatiminnovationkapaltamaenergibulakleegdindasalteachernamahotelpamantiniksandalinabiglalumindolpakealammemberssigndennerestaurantgabrielplasakelantoynaglabananbaropagodpangitpancitjoseinfectiousbotantelalatiniolarousamasayangplacecommunitycompostelaaccedergisinginantokclientsgearpeepcebubipolarnamingpumuntaresearchsparkestablishjoke