Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "enforcing"

1. Football referees are responsible for enforcing the rules of the game and ensuring player safety.

2. Hockey referees are responsible for enforcing the rules of the game and ensuring player safety.

3. The executive branch, represented by the President of the United States, is responsible for enforcing laws

Random Sentences

1. People who give unsolicited advice are a dime a dozen.

2. A palabras necias, oídos sordos. - Don't listen to foolish words.

3. Nous avons opté pour une cérémonie de mariage intime.

4. Einstein's most famous equation, E=mc², describes the relationship between energy and mass.

5. Naglalaway ang mga tao sa pila habang nag-aabang sa paboritong fast food chain.

6. The art class teaches a variety of techniques, from drawing to painting.

7. Sa gitna ng galit at poot, nahihirapan akong makapagpatuloy sa aking buhay.

8. The President is elected every four years through a process known as the presidential election

9. Después del nacimiento, la madre necesitará tiempo para recuperarse y descansar, mientras que el bebé necesitará atención constante y cuidado.

10. Nicole Kidman is an Academy Award-winning actress known for her performances in movies such as "Moulin Rouge!" and "The Hours."

11. Ang pagpapahalaga at suporta ng aking mga kaibigan ay nagpawi ng aking takot at pag-aalinlangan.

12. Los niños a menudo disfrutan creando arte como una actividad educativa y divertida.

13. Sa kanyang masamang gawain, nai-record ng CCTV kung paano siya na-suway sa patakaran ng paaralan.

14. Tila may nagseselos sa bagong kasapi ng grupo.

15. The credit card statement showed unauthorized charges, so I reported it to the bank.

16. Ang bilis nya natapos maligo.

17. Ano ang ginagawa ni Trina tuwing Mayo?

18. Hindi na nga nakatindig si Aya at sa inis nito ay gumapang patungong hagdanan.

19. Saan itinatag ang La Liga Filipina?

20. Pagkakataon na ni Ogor upang sumahod.

21. Ay shet. Ano ba yun natanong ko. Biglaan.

22. Ang gusto sana namin ay dalawang double beds.

23. Pinuntahan ng pasyente ang doktor.

24. Napaangat ako ng tingin sa kanya saka tumango.

25. Ito lang naman ang mga nakalagay sa listahan:

26. Børn er en vigtig del af samfundet og vores fremtid.

27. Claro, puedes hacer todas las preguntas que quieras.

28. Ituturo ni Clara ang tiya niya.

29. Larry Bird was a versatile forward and one of the best shooters in NBA history.

30. Fødslen kan også være en tid til at forbinde med ens partner og skabe en dybere forståelse og respekt for hinanden.

31. Ang sabi naman ni Bereti ay naiinggit kay Karing dahil marami itong bagay na nararanasan na hindi niya nararanasan.

32. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

33. Environmental protection requires a long-term vision and commitment to future generations.

34. Dala ito marahil ng sumpa sa iyo ni Matesa.

35. Gumising ka na. Mataas na ang araw.

36. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

37. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

38. Has he finished his homework?

39. Elektroniske apparater kan hjælpe med at forbedre undervisning og læring i uddannelsessystemet.

40. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

41. Dahil sa biglaang trapik, na-late ako sa meeting ko kanina.

42. Cancer survivors can face physical and emotional challenges during and after treatment, such as fatigue, anxiety, and depression.

43. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

44. La privacidad en línea es un tema importante que debe ser considerado al navegar en internet.

45. Tatlong araw na po akong hindi kumakain at palabuy-laboy dahil sa wala po akong tirahan, ang pagsumamo ng bata.

46. Ginising ko si Cross, Oy gising. Umaga na.

47. Ang pagkakaroon ng malubhang sakuna ay binulabog ang buong bansa.

48. Michael Jordan is widely regarded as one of the greatest basketball players of all time.

49. Las hierbas deshidratadas se pueden almacenar por más tiempo sin perder su sabor.

50. Hindi dapat umutang nang labis sa kakayahan ng pagbabayad upang maiwasan ang pagkakaroon ng financial burden.

Recent Searches

enforcingdaangfloorhitipinalitandroidknowledgeedit:mapbituinwebsitegotstreamingheftyclassmategappagapangninapagpapakalatnagbabakasyonmalikotnaglalakadkusineropinagkasundoalagangpatakasduonnasasalinangrammarzoomgranpinapataposanak-mahirapworldalingteachpasanlinggomabutinglaylaytripflightprogramspinapakiramdamanritwalnapapatungobusabusinganakabundukankinalimutanhallbeenukol-kaydropshipping,constantantestravelernitowindowformsengkantadanaiwangsementosandalingendviderefollowedipinansasahogibabawtenidoairplanesmagbubukidpinagsanglaanbibilipresyopapanhiknanghihinanakakasamabinibiyayaannakitaobra-maestrakomunikasyonlumalakihealthiersineidea:binigyangpodcasts,naglahonakasakitmaipapautangpagkaangatnangangalitmahiwagainvestnagbantaypansamantalakissyumabongpagtangisdiretsahangpaumanhinliv,matalinosaritapinagkiskismagkapatidmadalinglalabhantaglagaskumirotlaruinnaiilangdyipnikulungankinalalagyankinumutanistasyonsignalnabiawangmalalakicanteennavigationnamuhayhagdanannamumularektanggulonahigitanmagalitisinamamadadalaunconstitutionalsarisaringtherapeuticspwedengbilibidvaliosapapalapitdagat-dagatansapotituturogaanoandresdasalbalatmariaapologeticthroatsikipmatikmannunohumblegodtaumentarinulitdisseaksidentejenabateryamulighedernagmistulangsweetkablankadaratingaywansuotdemocracytiketcalciumlagiabrilmeannuclearbutilsumapiteksaytedsamuideyaimaginationlulusogforcesgamesdyanmalinisroseoliviasubjecttingtelangtoothbrushparagraphsmaitimbintanastateipagtimplaparatingoffentliglightsdanceboy4th