Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "cryptocurrency"

1. Bitcoin is the first and most well-known cryptocurrency.

2. Cryptocurrency can be used for both legal and illegal transactions.

3. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

4. Cryptocurrency exchanges allow users to buy, sell, and trade various cryptocurrencies.

5. Cryptocurrency has faced regulatory challenges in many countries.

6. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

7. Cryptocurrency is a digital or virtual currency that uses cryptography to secure and verify transactions.

8. Cryptocurrency is often subject to hacking and cyber attacks.

9. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

10. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

11. Cryptocurrency operates independently of central banks and governments.

12. Cryptocurrency wallets are used to store and manage digital assets.

13. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

14. Initial coin offerings (ICOs) are a means of raising capital through cryptocurrency crowdfunding.

15. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

16. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

17. Some businesses and merchants accept cryptocurrency as payment.

18. Some people invest in cryptocurrency as a speculative asset.

19. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

20. The blockchain technology underlying cryptocurrency allows for secure and transparent transactions.

21. The value of cryptocurrency can fluctuate rapidly due to market forces.

Random Sentences

1. Panay pa ang post nito sa facebook ng bagong damit eh hiram lang naman nya ang lahat nang yun.

2. El cultivo de hortalizas es fundamental para una alimentación saludable.

3. El perro de mi amigo es muy juguetón y siempre me hace reír.

4. Hinabol kami ng aso kanina.

5. Regular grooming, such as brushing and bathing, is important for a dog's hygiene.

6. The song went viral on TikTok, with millions of users creating their own videos to it.

7. Naaksidente ang aming plano sa bakasyon dahil sa pagbaha sa lugar na aming pupuntahan.

8. Les jeux de hasard en ligne sont devenus plus populaires ces dernières années et permettent de jouer depuis le confort de son propre domicile.

9. Marami ang nahuhumaling sa larong mobile legends.

10. The value of cryptocurrency can fluctuate rapidly due to market forces.

11. I woke up early to call my mom and wish her a happy birthday.

12. La seguridad en línea es importante para proteger la información personal y financiera.

13. Bilang paglilinaw, ang pagsasanay ay para sa lahat ng empleyado, hindi lang sa bagong hire.

14. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

15. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

16. Ang pangamba ay maaaring maging dahilan ng hindi pagpunta sa mga lugar na hindi pamilyar sa atin.

17. Ginagamit ang salitang "waring" upang ipahiwatig ang isang hinuha o tila isang bagay na maaaring totoo, ngunit hindi pa tiyak.

18. I am enjoying the beautiful weather.

19. Television has a rich history, and its impact on society is far-reaching and complex

20. This has led to a rise in remote work and a shift towards a more flexible, digital economy

21. Haha! Who would care? I'm hiding behind my mask.

22. I received a lot of gifts on my birthday.

23. The hotel room had an absolutely stunning view of the city skyline.

24. Nationalism can also lead to a sense of superiority over other nations and peoples.

25. Las escuelas son responsables de la educación y el bienestar de los estudiantes.

26. Pinalitan nya ng diaper ang umiiyak na sanggol.

27. Kahit mayroon akong mga agam-agam, hindi ko ito dapat ikumpara sa iba dahil may kanya-kanyang paghihirap ang bawat isa.

28. Sa mga liblib na lugar, ang mga punong-kahoy ay nagbibigay ng sapat na kahoy para sa mga pangangailangan sa konstruksiyon at pang-araw-araw na gawain.

29. Pagkababa, mabilis na siyang nagyayang umuwi.

30. El invierno es la estación más fría del año.

31. Scientific analysis has revealed that some species are at risk of extinction due to human activity.

32. Ang laki-laki ng cardigan na ito.

33. Ang Ibong Adarna ay may mahabang kwento na puno ng kaguluhan at kababalaghan.

34. Si Ogor, na kamakailan lamang ay bumabag sa kanya, ang malimit magsisimula ng panunukso.

35. Tuwing umagang mananaog siya upang umigib, pinagpapaalalahanan siya ng ina.

36. Les soins de santé mentale de qualité sont essentiels pour aider les personnes atteintes de maladies mentales à vivre une vie saine et productive.

37. Talagang dito ho sa palengke'y maraming naglipanang batang gaya niyan

38. Anong lugar ang pinangyarihan ng insidente?

39. Sa kanyang masamang gawain, nai-record ng CCTV kung paano siya na-suway sa patakaran ng paaralan.

40. Medyo kakaiba ang pusang ito sapagkat makapal ang kulay dalandan na balahibo.

41. Oscilloscopes can capture and store waveforms for further analysis and comparison.

42. Aba oo, yun lang pala, nakakunot-noong sagot ni Kablan.

43. Maaaring magdulot ng sakit sa kalooban ang mga dental problem, kaya't mahalagang agapan ito upang maiwasan ang mas malalang kalagayan.

44.

45. Omelettes are a popular choice for those following a low-carb or high-protein diet.

46. Antes de irme, quiero decirte que te cuídes mucho mientras estoy fuera.

47. May bagong dokumentaryo na ginawa ukol kay Apolinario Mabini.

48. La comida que preparó el chef fue una experiencia sublime para los sentidos.

49. The acquired assets included several patents and trademarks.

50. She helps her mother in the kitchen.

Similar Words

cryptocurrency:

Recent Searches

lamesacryptocurrencybalingulamroofstockbilinownsamfundputahesatisfactioncuentanbellpageagaotrosumamapersonshitpartnerprivatenamethroughoutballbringingcomputereumarawlabananchefnaggingfurthernagliliwanagpagnanasabranchcornerstopichjemstedinformedamountedit:ryanreadandybinuksanlimitmangemalinis4thmagta-trabahopinagmamalakiinabutannakainmahinangjuegospaghaliknagniningninghawaiiilanbeennagdabogpadabogibinaonbankhinamakbadingmassachusettsnababalot1929extrahimigpinakamagalingikinasasabiknakakapagpatibayculturamagkikitagodopoawtoritadongforskel,pakakatandaanmagtataasromanticismotumagalpagkatakotmorningpamilihang-bayanitokapagnapapatungomanlalakbaymagasawangpaghalakhakkikitanaguguluhangnagkapilatpaki-translatenakikianaguguluhanpinag-aaralansasamahanrevolutionerettagtuyottaun-taonpupuntahanshutipinatawagpakikipaglabanmagtagonailigtasprimeroskamandaggawinnangyarinakapagproposemasaktanskirttemperaturahouseholdnaghilamostumamisharapannakasakaypinagbubuksanlumusoblungsodtinatanongnabiawangcompaniestelebisyongawainkangitanganyanipapaputolumiilingpapayakinakainamuyinnasunogattorneybilibidlever,bintanapromisefollowingsunud-sunodpagmasdanbahagyangtaksieksport,kassingulanggotsimulamariloubayangisipaninnovationkubomarielvegasnakabiladalakmatitigasdiseasemanilasakimpondobundokipinanganaksinumanasomatipunoilocosiconicangkanpatunayansalitangginaganoonmalihisboholhealthlaryngitispunsomalayangbasahinkasomournedpangitdiagnosescommunitybinibinibusyangneatonightmanuscriptgearsuffercoaching:tryghedotraslimosnatingala