Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "cryptocurrency"

1. Bitcoin is the first and most well-known cryptocurrency.

2. Cryptocurrency can be used for both legal and illegal transactions.

3. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

4. Cryptocurrency exchanges allow users to buy, sell, and trade various cryptocurrencies.

5. Cryptocurrency has faced regulatory challenges in many countries.

6. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

7. Cryptocurrency is a digital or virtual currency that uses cryptography to secure and verify transactions.

8. Cryptocurrency is often subject to hacking and cyber attacks.

9. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

10. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

11. Cryptocurrency operates independently of central banks and governments.

12. Cryptocurrency wallets are used to store and manage digital assets.

13. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

14. Initial coin offerings (ICOs) are a means of raising capital through cryptocurrency crowdfunding.

15. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

16. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

17. Some businesses and merchants accept cryptocurrency as payment.

18. Some people invest in cryptocurrency as a speculative asset.

19. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

20. The blockchain technology underlying cryptocurrency allows for secure and transparent transactions.

21. The value of cryptocurrency can fluctuate rapidly due to market forces.

Random Sentences

1. Inflation kann sowohl kurz- als auch langfristige Auswirkungen auf die Wirtschaft haben.

2. Pinamunuan niya ang mga Pilipino laban sa mga Espanyol at kalaunan sa mga Amerikano.

3. Hindi madaling mahuli ang mailap na pag-asa.

4. Kahit na maliit ang kanyang bahay, basta't nagmamahalan ang mga tao, sapat na iyon.

5. Los juegos de mesa son un pasatiempo divertido para jugar en familia o con amigos.

6. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

7. Ang mga pag-uusig at pang-aapi ay mga halimbawa ng malubhang paglapastangan sa karapatan ng tao.

8. Sumuway sya sa ilang alituntunin ng paaralan.

9. Ngayon lang ako nag mahal ng ganito.

10. Naisip niyang mag-iwan ng masamang karanasan sa likod at simulan ang panibagong buhay.

11. Makikita ko si Mrs. Santos bukas.

12. La arquitectura es una forma de arte que se centra en el diseño y construcción de edificios.

13. Narinig ni Ana ang boses ni Noel.

14. Pinagtatalunan nila kung sino ang mas may karapatang manirahan sa malago at mayamang kagubatan.

15. Les soins de santé de qualité sont un droit fondamental de chaque individu.

16. Nakatira si Nerissa sa Long Island.

17. Pada umumnya, keluarga dan kerabat dekat akan berkumpul untuk merayakan kelahiran bayi.

18. Ang tubig-ulan ay maaaring magdulot ng malinis na hangin sa pamamagitan ng pag-alis ng polusyon sa hangin.

19. Si Pedro ay namamanhikan na sa pamilya ni Maria upang hingin ang kanilang pahintulot na magpakasal.

20. Bilang paglilinaw, hindi ako nagsabi na aalis ako, kundi lilipat lang ako ng departamento.

21. L'auto-discipline est également importante pour maintenir la motivation, car elle permet de s'engager dans des actions nécessaires même lorsque cela peut être difficile.

22. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

23. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

24. Sa loob ng paaralan, ang ingay ng mga mag-aaral ay binulabog ang kasiyahan ng mga guro.

25. Wie geht's? - How's it going?

26. The cake was a hit at the party, and everyone asked for the recipe.

27. Baby fever is a term often used to describe the intense longing or desire to have a baby.

28. He used his credit to buy a new car but now struggles to make the monthly payments.

29. Oo. Pero kelangan.. susunod ka lang sa akin, ok ba yun?

30. Mi sueño es convertirme en un músico famoso. (My dream is to become a famous musician.)

31. Dahil sa pangyayaring ito, mas lalong natakot ang mga taong bayan na lumapit sa puno.

32. Overcoming frustration requires patience, persistence, and a willingness to adapt and learn from mistakes.

33. Naririnig ko ang malakas na tunog ng ulan habang ako ay tulala sa bintana.

34. Nosotros preparamos una gran cena para celebrar la Nochebuena.

35. Pumunta kami sa Cebu noong Sabado.

36. Napanood ko ang concert ng aking paboritong banda kaya masayang-masaya ako ngayon.

37. Agad niyang dinala ito kay Mang Sanas.

38. Ngumiti siya at lumapit kay Maico.

39. Gamit niya ang kanyang laptop sa proyekto.

40. Gaano katagal niyang hinintay ang pakete?

41. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

42. Det har også ændret måden, vi interagerer med teknologi

43. Taman Mini Indonesia Indah di Jakarta adalah tempat wisata yang menampilkan miniatur kebudayaan Indonesia dari 33 provinsi.

44. Einstein was offered the presidency of Israel in 1952, but declined the offer.

45. Cancer can be diagnosed through medical tests, such as biopsies, blood tests, and imaging scans.

46. Hindi ako sang-ayon sa pag-uugali ng ilang mga kabataan ngayon.

47. Allen "The Answer" Iverson was a lightning-quick guard known for his scoring ability and crossover dribble.

48. Nasa labas ka ba? Teka puntahan kita dyan.

49. Kahit ubuhin sila sa nakasusulasok na mga basura, araw at gabing nagbantay ang mga taong bayan at mga kawal.

50. Sinadyang hindi magsuot ng mahal na damit si Juan sa kanyang pamamamanhikan upang magkaruon ng mas malamig na pakiramdam.

Similar Words

cryptocurrency:

Recent Searches

cryptocurrencybumahaseekdalawsaanmalagoteleviewingpinyaspentbuwankatapattrajetransportmaubosgamesngpuntalackditoalinglabingjackzgabepocaadditionhimigcontinuedlightsitinuringbadingrestferrergawinresponsibleeyeetoataquesshiftclassesexplainwhetherpatrickipinalutocontrolledscalemakestechnologiesimprovedotrovirksomhedernanaogmalamigkinadulocampaignsimikfulfillmentklasemataassakopnaka-smirknapadungawkamakalawawednesdaynagsisilbibuhoknanooditaasislamadetinderanapatinginmaramimorninglangmasyadongrelievednapakatagalmakalaglag-pantynegosyomasimbeschumochosbooksemphasisbangladeshpumapasokbasketballmayabongnglalababatangkomunikasyonpinakamaartengpagsumamosimbahanrevolucionadokaaya-ayangmagasawangkinatatakutannagmamaktolendingnagpagupitmakikikainhouseholdseconomysiniyasatinaabutannakatapatnag-poutkagandahanaraw-tumakaskwartonalamaninjurynabighanimahiwagapakakatandaanpinapalonagtalagaenterpoorerpamagatnasaananyopasyentenaghihirapkamandagnakabibingingkulungankinumutanmaluwagsubject,pumikitsinisiracompanieshagdananpaligsahanpalasyosampaguitarenaiakatagangperseverance,anunguniversitiesmasungitebidensyamandirigmanghatinggabirabeprosesoestateanghelsumpainnilalangangkopipagmalaakidiseasealmacenarkumaripaspepeparibangkomagkasinggandakingdombiligivernamakuyabagyosilbingpiecesgatheringbairdbilaotransmitsmakasarilingbasahanerapkwebangwidestapleasimplacemaskpinalutoloridedication,reservedjacetanimconvertidaselectionssumugoddatipupuntadayfanstekstgamesumala