Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

47 sentences found for "don"

1. A palabras necias, oídos sordos. - Don't listen to foolish words.

2. Anak, iwasan mo si Don Segundo, baka ikaw ay mapahamak, pagpapaalaala ng nangangambang ina.

3. Ariana is also an accomplished actress in film, with roles in movies like Don't Look Up (2021).

4. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

5. Don't be fooled by the marketing gimmick, there's no such thing as a free lunch.

6. Don't beat around the bush with me. I know what you're trying to say.

7. Don't count your chickens before they hatch

8. Don't cry over spilt milk

9. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

10. Don't give up - just hang in there a little longer.

11. Don't put all your eggs in one basket

12. Don't spill the beans about the project, it's supposed to be a secret.

13. Don't underestimate someone because of their background - you can't judge a book by its cover.

14. Don't waste your money on that souvenir, they're a dime a dozen in the market.

15. Don't worry about making it perfect at this stage - just get your ideas down on paper

16. Don't worry, it's just a storm in a teacup - it'll blow over soon.

17. Du behøver ikke at skynde dig så meget. Vi har masser af tid. (You don't need to hurry so much. We have plenty of time.)

18. Hang in there and don't lose hope - things will turn around soon.

19. I don't eat fast food often, but once in a blue moon, I'll treat myself to a burger and fries.

20. I don't have time for you to beat around the bush. Just give me the facts.

21. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

22. I don't like to make a big deal about my birthday.

23. I don't think we've met before. May I know your name?

24. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

25. I don't want to beat around the bush. I need to know the truth.

26. I don't want to cut corners on this project - let's do it right the first time.

27. I don't want to get my new shoes wet - it's really raining cats and dogs out there.

28. I don't want to go out in this weather - it's absolutely pouring, like it's raining cats and dogs.

29. I don't want to spill the beans about the new product until we have a proper announcement.

30. I've got a big presentation at work today - I hope I don't break a leg!

31. If you don't want me to spill the beans, you'd better tell me the truth.

32. If you want to maintain good relationships, don't burn bridges with people unnecessarily.

33. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

34. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

35. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

36. Maaf, saya tidak mengerti. - Sorry, I don't understand.

37. My dog hates going outside in the rain, and I don't blame him - it's really coming down like it's raining cats and dogs.

38. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

39. Pardon me, but I don't think we've been introduced. May I know your name?

40. Saya tidak setuju. - I don't agree.

41. Sayang, jangan khawatir, aku selalu di sini untukmu. (Don't worry, dear, I'm always here for you.)

42. Sayang, jangan lupa untuk makan malam nanti. (Dear, don't forget to have dinner tonight.)

43. Skynd dig ikke for meget. Du kan falde og slå dig. (Don't hurry too much. You might fall and hurt yourself.)

44. The early bird gets the worm, but don't forget that the second mouse gets the cheese.

45. Tolong jangan lakukan itu. - Please don't do that.

46. Tse! Anong pakialam nyo? Bakit maibibigay ba ninyo ang naibibigay sa akin ni Don Segundo? sagot ni Aya.

47. Upang huwag nang lumaki ang gulo ay tumahimik na lang si Busyang, nagpatuloy naman sa pakikipagtagpo sa mayamang Don Segundo ang ambisyosang anak.

Random Sentences

1. Tak ada gading yang tak retak.

2. Mi aspiración es trabajar en una organización sin fines de lucro para ayudar a las personas necesitadas. (My aspiration is to work for a non-profit organization to help those in need.)

3. Siya ay hinugot mula sa kanyang pagkakakulong matapos ma-prove na walang kasalanan.

4. Some businesses and merchants accept cryptocurrency as payment.

5. Hindi ako makahinga nang maayos kaya nanghina ako at nag-halinghing nang malalim.

6. Nagitla siya nang bago pa makalapit ay nagpalit anyo ito.

7. Saan ka kumuha ng ipinamili mo niyan, Nanay?

8. An oscilloscope is a measuring instrument used to visualize and analyze electrical waveforms.

9. It is often characterized by an increased interest in baby-related topics, including baby names, nursery decor, and parenting advice.

10. Gusto ko pumunta, pero pagod na ako.

11. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

12. Sin agua, los seres vivos no podrían sobrevivir.

13. Taman Mini Indonesia Indah di Jakarta adalah tempat wisata yang menampilkan miniatur kebudayaan Indonesia dari 33 provinsi.

14. Nagsimula na akong maghanap ng mga magagandang lugar upang dalhin ang aking nililigawan sa isang romantic date.

15. Many cultures have traditional sweet treats, such as baklava, churros, and mochi.

16. Pagkatapos ay muling naglaro ng beyblade kasama ang mga pinsan.

17. Mengatasi tantangan hidup membutuhkan ketekunan, ketabahan, dan keyakinan pada kemampuan kita sendiri.

18. Sa panahon ng digmaan, madalas na nangyayari ang mga krimen laban sa karapatang pantao.

19. Hindi na niya kaya ang mabibigat na gawain dahil mababa ang kanyang lakas.

20. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

21. Wives can also play a significant role in raising children and managing household affairs.

22. Sa mga kasal, kadalasan ay mayroong pagbibigay ng regalo sa mga panauhin bilang pasasalamat sa pagdalo.

23. Las suturas se utilizan para cerrar heridas grandes o profundas.

24. Tinignan ko siya sa nagtatanong na mata.

25. Hindi ko inakalang siya ang nangahas na maglagay ng graffiti sa pader ng paaralan.

26. Bagay na bagay sa kanya ang suot na traje de boda.

27. Napaluhod siya sa madulas na semento.

28. Sige.. pupunta tayo sa Jeju Island next March 26..

29. My boss accused me of cutting corners on the project to finish it faster.

30. Revise and edit: After you have a complete draft, it's important to go back and revise your work

31. Natutuhan ng mga mag-aaral ang talambuhay ni Heneral Luna at ang kanyang ambisyon para sa pagbabago ng bayan.

32. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

33. Les élèves doivent travailler dur pour obtenir de bonnes notes.

34. Les patients peuvent avoir besoin de soins palliatifs pendant leur hospitalisation.

35. Madalas siyang sumusulat kapag nag-iisa.

36. Ang pangungutya ay hindi magbubunga ng maganda.

37. The Constitution of the United States, adopted in 1787, outlines the structure and powers of the national government

38. Paano po pumunta sa Greenhills branch?

39. Kay sikip na ng daraanan ay patakbo ka pa kung lumabas!

40. Scissors are commonly used for cutting paper, fabric, and other materials.

41. Einstein's work led to the development of technologies such as nuclear power and GPS.

42. Ano ang kinakain niya sa tanghalian?

43. Nag-ayos ng gamit ang mga mag-aaral nang limahan.

44. Hindi hadlang ang kahirapan sa pagiging bukas palad, ang kailangan mo lang ay malasakit sa kapwa.

45. She draws pictures in her notebook.

46. He has been building a treehouse for his kids.

47. It takes one to know one

48. Have you been to the new restaurant in town?

49. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

50. Hindi na niya napigilan ang paghagod ng kanin sa kanyang plato at naglalaway na siya.

Similar Words

LondonMasyadongawtoritadongdontdumagundongRodonaSabadongdonedondedonationsDon't

Recent Searches

donleefistslegislativekusinakonsyertoinantaykinapanayaminyokanilaganapininnovationfacilitatingintramuroshidinghapongabingexhaustiondagatclassmatedalhanburdenbisikletabinilibinabatibigasbakaalagaabonokisameimportanteleveragesundalorevisemananahipamanhikandrewpang-araw-arawsuzettehumigit-kumulangnoongnagtaposmagpalagoemnerbabasahinadvancementssapotmatapobrenginuulcerpagsuboktrinakumikinigmahawaankinagalitansalamangkeroalapaapmedya-agwaoktubretitokinikitamakakasahodpoliticalsaanzebrakahuluganculturedekorasyonjingjingfysik,nagdadasalpananglawkanginanagagamitkaklasepagdudugopagkainismaintindihanpundidokampeonnatabunanpictureseksempelelementarygubatkubyertosvedvarendesapatosngitihahahaawagusalihanapinliligawantanyagnaglulusakmarinigrepublicanlakadherramientasmaranasanpangkattuvopagkattamadforskelrestaurantbinatakiskedyulhomecarbonsutililangcapitalisinalangdisposalsumigawhaddalandanbilinulamibigdollyloricigarettescafeteriaanimoconectadosnakakaenmaghahatidbarpaslitratecommercebalethoughtsannadooncorrectingexitinsteadhighestablepointandywalngnawalannetoamountpangingimisatineffektivtlawaylolanapakahusayoccidentaluntimelyokaybangpeppyeducationinangatnagsagawaphilippinenewskumunotumagangisinulatsesamefilmsilalimkaragatan,pagpapasakitnaalalakindergartenescuelasblusangkamatisasulctilesoncealitaptapganunkalikasantipidmuchanagtagalpagdukwangmasayahinbossmaglumakasgranadakalabantinanongelectionsnaghihirapbanggainmagsi-skiingsiyang-siyadagat-dagatan