Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

54 sentences found for "make"

1. "Dogs are not our whole life, but they make our lives whole."

2. All these years, I have been working to make a positive impact on the world.

3. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

4. As a lender, you earn interest on the loans you make

5. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

6. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

7. Electric cars may have a higher upfront cost than gasoline-powered cars, but lower operating and maintenance costs can make up for it over time.

8. Foreclosed properties may be sold in as-is condition, which means the buyer may have to make repairs or renovations.

9. Forgiving ourselves is equally important; we all make mistakes, and self-forgiveness is a vital step towards personal growth and self-acceptance.

10. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

11. He used his credit to buy a new car but now struggles to make the monthly payments.

12. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

13. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

14. I don't like to make a big deal about my birthday.

15. I reached my credit limit on the card and couldn't make any more purchases.

16. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

17. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

18. Let's not make this into a big deal - it's just a storm in a teacup.

19. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

20. Make a long story short

21. Make sure to keep track of your sources so that you can properly cite them in your book

22. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

23. Mathematics can be used to analyze data and make informed decisions.

24. Mathematics can be used to model real-world situations and make predictions.

25. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

26. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

27. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

28. My brother and I both love hiking and camping, so we make great travel companions. Birds of the same feather flock together!

29. Negative self-talk and self-blame can make feelings of frustration worse.

30. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

31. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

32. Platforms like Zoom and Skype make it easy to connect with students or clients and provide your services

33. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

34. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

35. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

36. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

37. The bride and groom usually exchange vows and make promises to each other during the ceremony.

38. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

39. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

40. The study of viruses is known as virology, and scientists continue to make new discoveries about these complex organisms.

41. The uncertainty of the situation has made it difficult to make decisions.

42. The United States has a system of representative democracy, where citizens elect representatives to make decisions on their behalf

43. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

44. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

45. The website's social media buttons make it easy for users to share content on their social networks.

46. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

47. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

48. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

49. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

50. Viruses can mutate and evolve rapidly, which can make them difficult to treat and prevent.

51. When I'm feeling nervous about networking, I remind myself that everyone is there to break the ice and make connections.

52. When life gives you lemons, make lemonade.

53. Women make up roughly half of the world's population.

54. Work can also have a social aspect, providing opportunities to meet new people and make connections.

Random Sentences

1. The bride looked stunning in her wedding dress, truly a beautiful lady.

2. Mahirap kausapin ang mga taong maarte dahil sa kanilang pagiging kritikal sa bawat bagay.

3. Naibaba niya ang nakataas na kamay.

4. Have they finished the renovation of the house?

5. There are a lot of benefits to exercising regularly.

6. Mababa ang tingin niya sa sarili kahit marami siyang kakayahan.

7. He has fixed the computer.

8. The company’s momentum slowed down due to a decrease in sales.

9. William Henry Harrison, the ninth president of the United States, served for only 31 days in 1841 before his death.

10. Pinagbubuksan ko ang mga bintana.

11. Mathematics is a language used to describe and solve complex problems.

12. Kucing di Indonesia adalah hewan yang sering menjadi teman dan sahabat bagi pemiliknya.

13. Pagapang na bumaba ng hagdanan ang anak, sa pagsayad ng mga kamay nito sa lupa ay unti-unti itong nagbago.

14. Buwenas si Fe sa kanyang negosyo.

15. Anong oras natutulog si Katie?

16. Hindi ko matatanggap ang kanilang panukala dahil mayroon akong mga reservations dito.

17. I admire my mother for her selflessness and dedication to our family.

18. The company's board of directors approved the acquisition of new assets.

19. El tamaño y el peso del powerbank pueden variar según la capacidad de la batería.

20. The community admires the volunteer efforts of local organizations.

21. Inilagay nya sa poon ang biniling sampaguita.

22. Hockey has produced many legendary players, such as Wayne Gretzky, Bobby Orr, and Mario Lemieux.

23. Kahit saan man ako magpunta, hindi ko makakalimutan ang aking kaulayaw.

24. Ang buhay at mga akda ni Rizal ay patuloy na pinag-aaralan at pinag-aaralan ng mga estudyante at mga historyador sa buong mundo.

25. Sa tulong ng mapa, natukoy namin ang pinakamabilis na ruta patungo sa beach.

26. Omelettes are a popular choice for those following a low-carb or high-protein diet.

27. Maasim ba o matamis ang mangga?

28. I am not enjoying the cold weather.

29. Ang mga kasiyahan at salu-salo sa hapag-kainan ay nagdudulot ng kasiyahan sa bawat tahanan tuwing Chinese New Year.

30. Alam ko na may karapatan ang bawat nilalang.

31. Sa katagalan, natanggap na niya ang panunuksong ito.

32. May I know your name for our records?

33. Børn har brug for at lære om kulturelle forskelle og respekt for mangfoldighed.

34. Malayo ang tabing-dagat sa bahay namin.

35. Kill two birds with one stone

36. Bias and ethical considerations are also important factors to consider when developing and deploying AI algorithms.

37. Patuloy ako sa paglinga nang may mamataan ang mga mata ko.

38. They are cleaning their house.

39.

40. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

41. Nagpapadalhan na kami ng mga mensahe araw-araw dahil nililigawan ko siya.

42. Nakatapos na ako ng thesis kaya masayang-masaya ako ngayon.

43. Saan kami kumakain ng mami at siopao?

44. Hindi maaring magkaruon ng kapayapaan kung ang marahas na kaguluhan ay patuloy na magaganap.

45. Bakso adalah bola daging yang disajikan dengan mie dan kuah kaldu.

46. Kailan nangyari ang aksidente?

47. El discurso del líder produjo un gran entusiasmo entre sus seguidores.

48. Kasama ko ang aking mga magulang sa pamanhikan.

49. El movimiento del baile contemporáneo tiene una elegancia sublime que conmueve al espectador.

50. A lot of birds were chirping in the trees, signaling the start of spring.

Similar Words

makes

Recent Searches

makeformatbatatrycycleintelligencetopicbalangmediummonitoruloakopagkagustopasanliv,nageespadahanpinaghatidanpagkalitonamumuloteskuwelaselebrasyonihahatidparehongmakatatlokumikilospagtutolpinuntahanmagulayawmagkaibangnakangisingpalibhasaililibrenagsimulanaglabachristmassusunodmaliitmanakbonatutulogininomkilaypiyanomarchantoutpoststeveginisingeasierfridaylorilarryspecializedaudio-visuallynakakatawanagtitindapodcasts,kakuwentuhanunibersidadpinagsikapannagpapaniwalakalalakihankumukuhakawili-wilipinakamaartengfamehacertumahimiknakagalawmakikipaglarotinatawagnakumbinsitobaccosalenakakagalapinagpatuloynicotumamisnangapatdanmadungissundalomasyadongnakalockmagturopagamutannagagamitideyainaamintinaykinasisindakanpagsahodmoviemagkakaroonpambahaymahinangpagkabiglasabonggrabemanonoodbornpaosnangnahigaunothreeadoptedtsinelasmalimitlaamangnglalabamismoinstrumental1970sguerrerotumatawadmagawatrentatinatanongrolemodernemaisipdamittumigilkanyanatabunaniiwasankaliwafysik,hinihintaysuzettemantikamatandamayabangelementaryresultasanaybakasyonmanuelsalitamahinatelebisyonlupapunoanimtamadiliginginanakakapuntaiikotmasukoljolibeenahantaddakilangaregladoplanning,karaniwangpatonganumanyamancoughingsinisijennysmilemaghahandasinungalinghinintaybesesexperts,backpackkayasapilitangsandalilalakebagkuscarrieskriskahimayiniyakphilippinetaga-nayondreamkumainmalihisnapatinginwaternakacharismaticninonglenguajesitawautomationlibrobingisaykalakingdinanasiilanhdtvtshirtkongmartesitinulosaalis