Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

54 sentences found for "make"

1. "Dogs are not our whole life, but they make our lives whole."

2. All these years, I have been working to make a positive impact on the world.

3. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

4. As a lender, you earn interest on the loans you make

5. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

6. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

7. Electric cars may have a higher upfront cost than gasoline-powered cars, but lower operating and maintenance costs can make up for it over time.

8. Foreclosed properties may be sold in as-is condition, which means the buyer may have to make repairs or renovations.

9. Forgiving ourselves is equally important; we all make mistakes, and self-forgiveness is a vital step towards personal growth and self-acceptance.

10. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

11. He used his credit to buy a new car but now struggles to make the monthly payments.

12. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

13. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

14. I don't like to make a big deal about my birthday.

15. I reached my credit limit on the card and couldn't make any more purchases.

16. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

17. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

18. Let's not make this into a big deal - it's just a storm in a teacup.

19. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

20. Make a long story short

21. Make sure to keep track of your sources so that you can properly cite them in your book

22. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

23. Mathematics can be used to analyze data and make informed decisions.

24. Mathematics can be used to model real-world situations and make predictions.

25. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

26. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

27. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

28. My brother and I both love hiking and camping, so we make great travel companions. Birds of the same feather flock together!

29. Negative self-talk and self-blame can make feelings of frustration worse.

30. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

31. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

32. Platforms like Zoom and Skype make it easy to connect with students or clients and provide your services

33. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

34. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

35. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

36. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

37. The bride and groom usually exchange vows and make promises to each other during the ceremony.

38. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

39. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

40. The study of viruses is known as virology, and scientists continue to make new discoveries about these complex organisms.

41. The uncertainty of the situation has made it difficult to make decisions.

42. The United States has a system of representative democracy, where citizens elect representatives to make decisions on their behalf

43. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

44. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

45. The website's social media buttons make it easy for users to share content on their social networks.

46. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

47. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

48. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

49. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

50. Viruses can mutate and evolve rapidly, which can make them difficult to treat and prevent.

51. When I'm feeling nervous about networking, I remind myself that everyone is there to break the ice and make connections.

52. When life gives you lemons, make lemonade.

53. Women make up roughly half of the world's population.

54. Work can also have a social aspect, providing opportunities to meet new people and make connections.

Random Sentences

1. The members of the knitting club are all so kind and supportive of each other. Birds of the same feather flock together.

2. Ang paglabas ng impormasyon tungkol sa isang malaking skandalo ay binulabog ang buong bansa.

3. Las redes sociales también son un medio para hacer negocios y promocionar productos.

4. Kung kasamaan pa rin ang nasa iyong pagiisip, sanay huwag kanang makatayo.

5. Nagkalat ang mga balat ng prutas kahit saan.

6. Les préparatifs du mariage sont en cours.

7. Nakasandig ang ulo sa tagpiang dingding.

8. The disagreement between them turned out to be a storm in a teacup.

9. Sa aming barangay, ipinamalas namin ang bayanihan sa pagtatayo ng bagong silid-aralan.

10. La science des matériaux est utilisée dans la fabrication de nombreux produits de la vie quotidienne.

11. Las escuelas son lugares de aprendizaje para estudiantes de todas las edades.

12. Fødslen kan være en fysisk og følelsesmæssig udfordring for både mor og far.

13. Fødslen kan være en tid til at reflektere over ens egne værdier og prioriteringer.

14. Bawal magpakalat ng mga pornograpikong materyal dahil ito ay labag sa batas.

15. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

16. Gusto ko sanang bumili ng bahay.

17. Ang bango ng lupa pagkatapos ng ulan ay nagdala ng mabango at sariwang simoy.

18. Busy sa paglalaba si Aling Maria.

19. Sa pagkain ng pulotgata, mahalaga na maghugas ng kamay upang hindi magkalat ang tamis sa ibang bagay.

20. Bilang ganting langit sa mga kabutihan nina Waldo at Busyang, sila ay pinagkalooban ng isang anak na pagkaganda-ganda.

21. Leukemia can be challenging to treat, and some patients may require multiple rounds of therapy.

22. Kawhi Leonard is known for his lockdown defense and has won multiple NBA championships.

23. Emphasis can also be used to create a sense of urgency or importance.

24. She reads books in her free time.

25. Ang mga construction worker nagsisilbi upang magtayo ng mga gusali at imprastraktura.

26. Ako'y lumilipad at nasa alapaap na.

27. Sa aksidente sa pagpapalipad ng eroplano, maraming pasahero ang namatay.

28. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

29. Ang poot ay isang damdamin na hindi madaling malunasan o mapawi.

30. Sa pook na iyon, sa nakaririmarim na pook na iyon, aba ang pagtingin sa kanila.

31. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

32. Si Mabini ay nagtrabaho bilang abogado bago naging bahagi ng rebolusyon.

33. Papasa ka kung mag-aaral ka ng leksiyon mo.

34. There are a lot of amazing destinations to explore around the world.

35. I discovered a new online game on a gaming website that I've been playing for hours.

36. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

37. Patawarin niyo po ako, nagpadala ako sa mga pagsubok.

38. For you never shut your eye

39. Tomar decisiones basadas en nuestra conciencia puede ser difícil, pero a menudo es la mejor opción.

40. Palibhasa ay may kakayahang makipag-usap sa ibang mga tao sa iba't-ibang antas ng kaalaman at pinag-aralan.

41. Ano pa ho ang pinagkakaabalahan ninyo?

42. Cryptocurrency exchanges allow users to buy, sell, and trade various cryptocurrencies.

43. Ang paggamit ng droga ay hindi lamang masamang bisyo, kundi pati na rin isang krimen laban sa iyong sarili at sa lipunan.

44. Kapag bukas palad ka sa iyong mga pangarap, mas madali itong makamit dahil hindi ka nagtatago sa mga taong pwedeng magbigay ng tulong.

45. Ma, wag mo akong iwan. Dito ka lang ma!

46. Sa pagtatapos ng seminar, ang mga dumalo ay nag-aapuhap ng mga kopya ng mga presentasyon.

47. Naiipit ang maraming tao sa pagsapit ng aksidente sa ilalim ng tulay.

48. Det er en metodisk tilgang til at forstå verden omkring os og finde årsager til de fænomener, vi observerer

49. Kailangan nating magbago ng mga lumang gawi, datapapwat ay mahirap ito gawin dahil sa kawalan ng disiplina ng iba.

50. No puedo controlar el futuro, así que "que sera, sera."

Similar Words

makes

Recent Searches

makeemailmagandanglinggo-linggolumamangkonsentrasyonpwedeamoairplanespagsilbihanniyangnasaktanmemoaraw-pigingafterpaglayasakmanapatunayandumeretsopanomasungitguhitsalitanginiibigpatutunguhanhipontirahanayawmababawreserveslatestninongbinigyangnaglaonkasisubalitgearnapilitanhiyanagsisipag-uwiannagtinginannagsasabingsaan-saannagnakawandroidkotsengnagpalipattensurgeryfollowednababalottakenumerosassarahitikduonbumuhostahananfurynangapatdantaga-hiroshimahumanapmayroonhalagapamamaganakatapatdumarayolosfakenapadpadstapleliligawanmagkasing-edadbalik-tanawinsektogandatawadbahaginglumagonapatinginbrancheshenrymoviestuladtaingaaudio-visuallygreatnilimasumabotbungarememberedpalusotmemoriabawathumanostanggalinlabaspersonspanalanginkahariannagkatinginangymnalugodmedisinahahatolbiyaheejecutarlintekkanyapekeanmagsugalsilaypinunitmangahasimeldanakasalubongshadeslingidmanuscriptstarted:facebookitinindigmagsisinebundokitukodsiksikankabundukankatolikohinilanasaanagaw-buhaybuhaydoubletumahanmalisannamamsyalgumandakinatitirikanbilhinpaghamakstrategykumaintingnanpaboritonatitirangplagassakimculturapwedengmataaaspulubibyggetkagatolnaiyakestablishcommercepaalamnausalmagtrabahotumuboilanpalangitiasalniyonmetoderyoungpagkikitaipinauutangturonginaganapwaripyestamulamagkanousedpativideostrajebarrierstelefonerbuntismarahangcommunitytactomatabagooglemang-aawitnilagangdrewnapatulalaeskwelahanminabutibalitasingsingniyonandoonuncheckedkinakailangangkailan