Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

54 sentences found for "make"

1. "Dogs are not our whole life, but they make our lives whole."

2. All these years, I have been working to make a positive impact on the world.

3. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

4. As a lender, you earn interest on the loans you make

5. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

6. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

7. Electric cars may have a higher upfront cost than gasoline-powered cars, but lower operating and maintenance costs can make up for it over time.

8. Foreclosed properties may be sold in as-is condition, which means the buyer may have to make repairs or renovations.

9. Forgiving ourselves is equally important; we all make mistakes, and self-forgiveness is a vital step towards personal growth and self-acceptance.

10. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

11. He used his credit to buy a new car but now struggles to make the monthly payments.

12. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

13. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

14. I don't like to make a big deal about my birthday.

15. I reached my credit limit on the card and couldn't make any more purchases.

16. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

17. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

18. Let's not make this into a big deal - it's just a storm in a teacup.

19. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

20. Make a long story short

21. Make sure to keep track of your sources so that you can properly cite them in your book

22. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

23. Mathematics can be used to analyze data and make informed decisions.

24. Mathematics can be used to model real-world situations and make predictions.

25. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

26. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

27. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

28. My brother and I both love hiking and camping, so we make great travel companions. Birds of the same feather flock together!

29. Negative self-talk and self-blame can make feelings of frustration worse.

30. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

31. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

32. Platforms like Zoom and Skype make it easy to connect with students or clients and provide your services

33. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

34. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

35. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

36. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

37. The bride and groom usually exchange vows and make promises to each other during the ceremony.

38. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

39. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

40. The study of viruses is known as virology, and scientists continue to make new discoveries about these complex organisms.

41. The uncertainty of the situation has made it difficult to make decisions.

42. The United States has a system of representative democracy, where citizens elect representatives to make decisions on their behalf

43. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

44. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

45. The website's social media buttons make it easy for users to share content on their social networks.

46. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

47. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

48. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

49. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

50. Viruses can mutate and evolve rapidly, which can make them difficult to treat and prevent.

51. When I'm feeling nervous about networking, I remind myself that everyone is there to break the ice and make connections.

52. When life gives you lemons, make lemonade.

53. Women make up roughly half of the world's population.

54. Work can also have a social aspect, providing opportunities to meet new people and make connections.

Random Sentences

1. Nagbigay siya ng magalang na pasasalamat sa tulong na ibinigay ng kanyang kaibigan.

2. Selain agama-agama yang diakui secara resmi, ada juga praktik-praktik kepercayaan tradisional yang dijalankan oleh masyarakat adat di Indonesia.

3. She reads books in her free time.

4. He has been gardening for hours.

5. Mabilis siyang natutunan ang mga bagong teknolohiya dahil sa kanyang natural na abilidad sa kompyuter.

6. Vivir con una conciencia limpia nos permite dormir mejor por la noche.

7. Ang pag-asa ay nagbibigay ng mga solusyon sa mga problema at hamon sa buhay na hindi magagawan ng paraan.

8. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

9. Hinatid ako ng taksi sa bahay ni Mrs. Lee.

10. Pinili ng mga magulang ang pinakamalapit na paaralan sa kanilang tahanan upang hindi na mahirapan ang mga bata sa pagbiyahe patungong silid-aralan.

11. Hindi dapat umasa sa mailap na mga pangako ng ibang tao.

12. Naalala nila si Ranay.

13. Nakakasama sila sa pagsasaya.

14. Different? Ako? Hindi po ako martian.

15. Los Angeles is home to several professional sports teams, including the Lakers (NBA) and the Dodgers (MLB).

16. Medarbejdere skal ofte undergå årlig evaluering af deres præstation.

17. Nagtuturo kami sa Tokyo University.

18. Nagkwento ang lolo tungkol sa multo.

19. Sa mga tabing-dagat, naglipana ang mga maliliit na kabahayan.

20. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

21. Minsan ay isang diwata ang nagpanggap na isang babaeng madungis.

22. Tila may bumisita sa bahay kagabi dahil may bakas ng paa sa labas.

23. Bis morgen! - See you tomorrow!

24. La película que produjo el estudio fue un gran éxito internacional.

25. Inalagaan niyang mabuti ang halaman at tinawag itong Pinang, Sa palipat-lipat sa bibig ng mga tao ang pinang ay naging pinya.

26. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

27. Ohne Fleiß kein Preis.

28. Los granjeros deben estar atentos al clima para saber cuándo es el mejor momento para cosechar.

29. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

30. Hindi ko alam kung bakit ang ibang tao ay madalas na mangiyak-ngiyak sa kahit anong bagay.

31. Gumawa si Mario ng maliit na bola mula sa papel.

32. Natutuwa ako kapag nakakakita ako ng isang halamanang mayabong sa mga pampublikong lugar.

33. Nakaramdam ako ng sakit kaya hinugot ko ang aking kamay upang pumigil.

34. Nagtatanong-tanong ako sa kanyang mga kaibigan upang malaman kung ano ang mga gusto at ayaw ng aking nililigawan.

35. The task of organizing the event was quite hefty, but we managed to pull it off.

36. I am exercising at the gym.

37. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

38. Ang laki ng sawa na kanyang nakita.

39. Ibinigay ko ang aking panahon at atensyon sa pagtitiis ngayon upang makamit ang magandang kinabukasan.

40. Ang digmaan ay maaaring magdulot ng mga trauma at sakit sa mga biktima at kalahok.

41. Mapapa sana-all ka na lang.

42. They travel to different countries for vacation.

43. Mahilig akong kumanta ng mga awiting gawa ng Bukas Palad.

44. Lahat sila ay angkan ng matatalino.

45. Waring may bagyong paparating dahil sa biglang pagdilim ng kalangitan.

46. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

47. Natatandaan ko pa nung bata ako na nagtatawanan kami ng mga kaibigan ko habang kumakain ng pulotgata.

48. Talaga ba Sharmaine?

49. Walang sinumang nakakaalam, sagot ng matanda.

50. Naglakad ang bata papuntang eskuwelahan.

Similar Words

makes

Recent Searches

lorenaadditionally,internatarcilamagkasinggandamakemagsusuotunconventionalmagsi-skiingtwoganitosakopsilaitopasensiyanariyantayosumusunogloriabuenanakadapatiyakcover,marilouganangwestumiisodkanayangliv,magkikitakuwartosisentapinapalovideos,diseasescoalnakaka-innanaloeksport,denpigilannahintakutanorderinhitapaketepinagpatuloymagkaibalalomarasigannakapagsabinapaiyakwalongsiempreguardabalatipinadalamerchandisesubjectmaskaraika-50misteryosalaminmatangkadtinangkaipinamilibinabalikbinigaynangingisaykasocynthiaandresidiomanatitiyakmakaipontinaasansahodmalamangotrobluepaki-chargenilayuandondeibigbetatemperaturawasakmay-bahayilihimnahulogpagkahaposinusuklalyangisingmagazinesiilanpamasahekarnabalpootvedapatnapumakikipagbabagstartuktoktiposabstaininglalargasourcespeterscheduleaaisshbehaviorpagpasensyahannamingsharingscalemakilalasatisfactionmakatuloglibaginsteadpamimilhingnagmumukhapartemahiwagalovehunyoputolginagawasakupintumakboanimarahaskalawakanpangyayaricardtagumpayscientistnagkwentopakinabanganlipadpag-iwantuparingumagalaw-galawbulagoposharmainesanggolpiratadumagundongtelecomunicacionesbecamehetomayabangbituinanumangexpeditednagtatanimpeksmanrebolusyonkamalayanngagagamitpagsidlanunosnakikitakinagalitankapilingpinasokumangattagalognaiwangmacadamiatumahimikemocionantekristopamumuhaydinanasmagpuntaalleilawestudyantepwedengfaultnaggalanagulatpangarapnakaangatmatulungintutoringcigarettepaglayashusoleukemiaformasslavesinehanpaggawanapawikumalmaayaweclipxe