Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

54 sentences found for "make"

1. "Dogs are not our whole life, but they make our lives whole."

2. All these years, I have been working to make a positive impact on the world.

3. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

4. As a lender, you earn interest on the loans you make

5. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

6. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

7. Electric cars may have a higher upfront cost than gasoline-powered cars, but lower operating and maintenance costs can make up for it over time.

8. Foreclosed properties may be sold in as-is condition, which means the buyer may have to make repairs or renovations.

9. Forgiving ourselves is equally important; we all make mistakes, and self-forgiveness is a vital step towards personal growth and self-acceptance.

10. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

11. He used his credit to buy a new car but now struggles to make the monthly payments.

12. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

13. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

14. I don't like to make a big deal about my birthday.

15. I reached my credit limit on the card and couldn't make any more purchases.

16. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

17. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

18. Let's not make this into a big deal - it's just a storm in a teacup.

19. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

20. Make a long story short

21. Make sure to keep track of your sources so that you can properly cite them in your book

22. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

23. Mathematics can be used to analyze data and make informed decisions.

24. Mathematics can be used to model real-world situations and make predictions.

25. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

26. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

27. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

28. My brother and I both love hiking and camping, so we make great travel companions. Birds of the same feather flock together!

29. Negative self-talk and self-blame can make feelings of frustration worse.

30. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

31. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

32. Platforms like Zoom and Skype make it easy to connect with students or clients and provide your services

33. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

34. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

35. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

36. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

37. The bride and groom usually exchange vows and make promises to each other during the ceremony.

38. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

39. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

40. The study of viruses is known as virology, and scientists continue to make new discoveries about these complex organisms.

41. The uncertainty of the situation has made it difficult to make decisions.

42. The United States has a system of representative democracy, where citizens elect representatives to make decisions on their behalf

43. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

44. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

45. The website's social media buttons make it easy for users to share content on their social networks.

46. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

47. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

48. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

49. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

50. Viruses can mutate and evolve rapidly, which can make them difficult to treat and prevent.

51. When I'm feeling nervous about networking, I remind myself that everyone is there to break the ice and make connections.

52. When life gives you lemons, make lemonade.

53. Women make up roughly half of the world's population.

54. Work can also have a social aspect, providing opportunities to meet new people and make connections.

Random Sentences

1. Walang mangyayari satin kung hindi tayo kikilos.

2. Pahiram ng iyong mga notepads at ballpen para sa aking meeting.

3. He won his fourth NBA championship in 2020, leading the Lakers to victory in the NBA Bubble.

4. Sa gitna ng dilim, natagpuan niya ang liwanag sa pamamagitan ng pag-iisa.

5. Nationalism can have a positive impact on social and economic development.

6. Pinagmamasdan niya ang magandang tanawin mula sa tuktok ng bundok.

7. Bagama't nawalan ng kapangyarihan ay naging maligaya naman ito sa piling ni Ramon at ng kanilang mga anak.

8. Ah yun ba? Si Anthony, taga ibang department.

9. Tumayo yung lalaki tapos nakita niya ako.

10. Tumitingin kami sa mapa para alamin ang mga shortcut papuntang eskwela.

11. Pinili niyang magtungo palayo sa gulo upang makahanap ng katahimikan.

12. Ano ang gagamitin mong hiwa ng baka?

13. Danau Toba di Sumatera Utara adalah danau vulkanik terbesar di dunia dan tempat wisata yang populer.

14. Nagbabaga ang damdamin ng bayan matapos ang mainit na balita tungkol sa katiwalian.

15. Hmmmm! pag-iinat ko as soon as magising ako. Huh?

16. Game ako jan! sagot agad ni Genna.

17. Mayroong dalawang libro ang estudyante.

18. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

19. Cryptocurrency wallets are used to store and manage digital assets.

20. The singer on stage was a beautiful lady with an incredible voice.

21. The festival showcases a variety of performers, from musicians to dancers.

22. Ligaya ang pangalan ng nanay ko.

23. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

24. Kebahagiaan tidak selalu tergantung pada materi atau kekayaan, tetapi pada keadaan batin dan kepuasan diri.

25. The cost of a wedding can vary greatly depending on the location and type of wedding.

26. Ang panaghoy ng kanilang awit ay nagbigay-inspirasyon sa mga tagapakinig.

27. Ano bang pinagsasasabi mo jan Kuya?

28. Omelettes are a popular choice for those following a low-carb or high-protein diet.

29. Paano ho ako pupunta sa palengke?

30. Sa mga perya, naglipana ang mga tao na naghahanap ng libangan.

31. She has been teaching English for five years.

32. Les chatbots d'intelligence artificielle peuvent aider les entreprises à répondre aux demandes des clients.

33. Ako naman, poker face lang. Hahaha!

34. Agad naman na ngpunta si Aling Edna sa bahay nila na daladala ang parte nila sa napaghatian na gulay at bigas.

35. He has been hiking in the mountains for two days.

36. Estoy sudando mucho. (I'm sweating a lot.)

37. Les scientifiques travaillent ensemble pour résoudre des problèmes complexes.

38. Hindi naman. Baka lang pagod ka na...

39. Alam ko pede kang mapagkatiwalaan, Peppy. Kaya please?

40. Sa isang linggo ay pupunta kami sa Singapore.

41. Maria, si Ginang Cruz. Guro ko siya.

42. Handa ko pong gawin ang lahat para lang tuparin Mo po ang aking kahilingan.

43. Bumilis bigla yung tibok ng puso ko.

44. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

45. I know we're behind schedule, but let's not cut corners on safety.

46. Les comportements à risque tels que la consommation

47. Oo. Tatawagan ka daw niya pag nandyan na siya.

48. Sa gitna ng kaniyang pag-aaral, napadungaw siya sa katabing silid at nakita ang kanyang kaibigan.

49. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

50. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

Similar Words

makes

Recent Searches

publishedprogressformatmakelasingelectemphasizedlibropracticesclassmatedontunangkararatingmedyogapphilosophicalevolucionadotodoopgavermundocorporationuriarmedbathalagenerationselectedgotoftepartrightclienteschefdebateslandekomunidadt-shirtlumiwagmanalokwenta-kwentaoktubrepamahalaannagbibiroiiyaktinderatagpiangnatutulogbooksakopwantmarketplacesdahil3hrstengaandresasongparaisobalatnataposnamekasingoverviewreleasedsang-ayontatawagbagkushumiwalaytamadiintayinintensidadsisikatkarapatangguerreropinipilitmaskinernagsisunodmatapangadobokalarosakayyantanonggigisingespigasengkantadadealkitangwellcoachingbasamagpaliwanagsakinsuzetteinvolvekinamumuhiannakayukoh-hoykalagayankayasagasaantotoongnahigitanrektanggulolinawmakisuyosunud-sunoditimtawamatikmanbinatakmulighederpangitbitiwanpagemaitimpararolledmapapaactorconditioningtagakkabarkadaexperts,pagkaingrolandhunitonyanungpalapagkubomaghatinggabirenaiapatutunguhannagpakitanageenglishgobernadorhitsurakinagigiliwangnagpalalimmaglalaromagkaibiganobservererpagkakamalinakalagaynagkakamalireserbasyonmakikiraanpinsaninteractkwartopagtawapambahaykalalaropangangatawannakatirapagtatanongpumapaligidmensajesnagbuntongmagsi-skiingdiscipliner,sinusuklalyanalapaaplot,ikinabitmagkasabaymakakabalikkongresopasyentemamimiliincomemanatilinaabotpasaheronaglutosiyudadpaidtuktokpumulotusuariopagtatakamaasahannapahintoritwaltonettekaninadakilangsigurobiglaansimbahanmasukolroofstockvictoriasukatinsumalakayoperativoshinugotcanteensumapitnakatingalaumalis