Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "robinhood"

1. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

Random Sentences

1. We have been painting the room for hours.

2. Libro ko ang kulay itim na libro.

3. Sinunod ni Mang Kandoy ang bilin ni Rodona.

4. Would you like a slice of cake?

5. Kahit hindi siya lumingon, para na niyang nakita si Ogor.

6. Dedication is the commitment and perseverance towards achieving a goal or purpose.

7. Los niños de familias pobres a menudo no tienen acceso a una nutrición adecuada.

8. Las bebidas calientes, como el chocolate caliente o el café, son reconfortantes en el invierno.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

10. If you think he'll agree to your proposal, you're barking up the wrong tree.

11. Unser Gewissen kann uns vor schlechten Entscheidungen bewahren und uns auf den richtigen Weg führen.

12. Akma siyang tatayo upang humingi ng tulong ng bigla siyang nalugmok sa kanyang kinauupuan.

13. The United States is the third-largest country in the world by land area and the third most populous country in the world.

14. And dami ko na naman lalabhan.

15. Nakakainis ang mga taong nagpaplastikan dahil hindi mo alam kung totoo ba ang sinasabi nila.

16. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

17. She spends hours scrolling through TikTok, watching funny videos and dance routines.

18. También cuentan con pantallas táctiles y una gran cantidad de memoria interna para almacenar información, fotos, videos y música

19. Esta comida está demasiado picante para mí.

20. Ang kalawakan ay punung-puno ng mga bituin.

21. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

22. Menghadapi tantangan hidup dengan keberanian dan tekad dapat membantu kita tumbuh dan mencapai tujuan yang kita impikan.

23. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

24. Oscilloscopes can be portable handheld devices or benchtop instruments with larger displays and advanced features.

25. Salamat po at pinagbigyan nyo ako.

26. Gracias por iluminar mi vida con tu presencia.

27. Make a long story short

28. Ang kalayaan ay hindi dapat nakasira sa kapakanan ng ibang tao.

29. Tahimik ang buong bahay, waring walang tao sa loob.

30. Ano ang nahulog mula sa puno?

31. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

32. Kapag mayroong hindi malinaw na impormasyon, madalas na nagkakaroon ng agam-agam sa mga tao.

33. Nahantad ang mukha ni Ogor.

34. Tesla has faced challenges and controversies, including production delays, quality control issues, and controversies surrounding its CEO, Elon Musk.

35. The dog does not like to take baths.

36. Gusto kong matutong tumugtog ng gitara.

37. She helps her mother in the kitchen.

38. Mabait ang dentista na naglinis ng aking ngipin.

39. Napatingin sila bigla kay Kenji.

40. "Ang hindi lumingon sa pinanggalingan, hindi makakarating sa paroroonan" ay isang bukambibig na nagpapahiwatig ng kahalagahan ng pag-alala at pagpahalaga sa mga pinagmulan.

41. The patient had a history of pneumonia and needed to be monitored closely.

42. Ibinili ko ng libro si Juan.

43. Every year, I have a big party for my birthday.

44. Claro que te apoyo en tu decisión, confío en ti.

45. Hindi tayo sigurado/nakatitiyak.

46. Jeg kan ikke skynde mig mere end jeg allerede gør. (I can't hurry more than I already am.)

47. Tara Beauty. Mag-gala naman tayo ngayong araw. aniya.

48. El algodón es un cultivo importante en muchos países africanos.

49. The company had to cut costs, and therefore several employees were let go.

50. Kumain ka na ba? Tara samahan kitang kumain.

Recent Searches

tilirobinhoodpokerabutansakaymarinigkainannababalotkatagangmatangumpaymatangkadhitmakaiponinalagaankantusindvispagdiriwangdesarrollarhoteltsupersalbahekargangpagkattawareynatasasirawhichtengalayuanmataaashumpaysagaptambayanmagigitingtelefonincidencecnicokatapatinakyatisamakalongmabaitpresleyasiatickulangteachernenastruggledpalangsumuotkumukulostuffedairconpopularsumasakitpongdibapagpapasakitnahihiloinihandamanghulidissemataraynahigasundaeelectronicassociationadoptedblusamanuksobuenahinognicobutchstonagtutulakkinsefilmsnapatinginyatamegetbilerselltoothbrushwritinghangaringfurlossbitiwanlapitanadicionalescapitaltransmitsblusangonlineattractivemangingisdamagsusunuranpageanimpinalutoneedkontramarkedcheckslikelyschooldecisionsarbejdsstyrkelayout,rateiospupuntaencountercoachingbinabaancompartenginisingtanawinitimfuncionardonetwinkleayudapresssutilmethodsprocessdoesusingprogramshatebehaviorvanfutureilingevolvedaggressionreleasediginitgithellonagpakunotkatuladmaliitlooblumuwaspalipat-lipatvirksomhedernamulatbuung-buolumiwanagerhvervslivetdahan-dahankelanactualidadnag-iimbitanagsuotlolananonoodorkidyaskinalimutanhinampaslalosumimangotaaisshaabotadecuadosalesgabinggisingpakisabirabbaforståayawandrespagputipaskongkahilinganmagtipidcoalgrammarsinampalhitikteachnilulonnaritofialuisdulaplaysibabamagbubungacreationstandtrainingbeyondimpactedinilalabasnaninirahan