Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "robinhood"

1. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

Random Sentences

1. Binigyan niya ako ng aklat tungkol sa kasaysayan ng panitikan ng Asya.

2. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

3. Hinipan-hipan niya ang manipis na dibdib.

4. Keep in mind that making money online takes time, effort, and patience

5. Les enseignants doivent évaluer les performances des élèves et leur donner des feedbacks constructifs.

6. Bigla, ubos-lakas at nag-uumiri siyang umigtad.

7. Don't waste your money on that souvenir, they're a dime a dozen in the market.

8. Huwag ring magpapigil sa pangamba

9. Nung natapos yung pag print, nakita nung babae yung pictures.

10. Captain America is a super-soldier with enhanced strength and a shield made of vibranium.

11. Nagkwento ang lolo tungkol sa multo.

12. Anong pangalan ng lugar na ito?

13. May problema ka ba? Kanina ka pa tulala eh..

14. Another area of technological advancement that has had a major impact on society is transportation

15. The early bird catches the worm

16. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

17. Hindi niya gustong maging nag-iisa sa buhay.

18. Napakabilis ng wifi sa kanilang bahay.

19. Aku rindu padamu. - I miss you.

20. Naglabas ng artikulo ang pahayagan ukol sa epekto ng social media sa kabataan.

21. Hashtags (#) are used on Twitter to categorize and discover tweets on specific topics.

22. Habang naglalaba ang kanyang ina ay walang tigil namang naglalaro si Juanito.

23. Danske virksomheder, der eksporterer varer til Kina, har haft stor succes på det kinesiske marked.

24. Paano magluto ng adobo si Tinay?

25. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

26. Owning a pet can provide companionship and improve mental health.

27. There are a lot of books on the shelf that I want to read.

28. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

29. Kulay itim ang libro ng kaklase ko.

30. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

31. Ang aking kaulayaw sa kanto ay nakatulong sa akin sa paghahanap ng trabaho.

32. Nationalism can inspire a sense of pride and patriotism in one's country.

33. Pasensya na, masama ang pakiramdam ko.

34. Ngunit parang walang puso ang higante.

35. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

36. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

37. May masarap na mga pagkain sa buffet, pero mahaba ang pila para sa mga kubyertos.

38. Inalagaan ng mag-asawa ang halaman at nang lumaki ay nagkabunga.

39. Naging hobby ko na ang paglalaro ng mobile games kaya nahuhumaling ako.

40. Ang mga pag-aaral sa kalusugang pang-mental ay nagbibigay-diin sa kahalagahan ng kamalayan sa mga isyu ng mental na kalusugan.

41. Sa kabila ng kanyang tagumpay, nananatiling humble at grounded si Carlos Yulo.

42. Ang maniwala sa sabi-sabi, walang bait sa sarili.

43. The acquired assets will give the company a competitive edge.

44. Está claro que la evidencia respalda esta afirmación.

45. Tsss. aniya. Kumunot pa ulit yung noo niya.

46. Lumiwanag ang lansangan dahil sa bagong ilaw trapiko.

47. Inflation kann sowohl kurz- als auch langfristige Auswirkungen auf die Wirtschaft haben.

48. Pumuslit ang luha sa sulok ng kanyang mga mata.

49. AI algorithms can be supervised, unsupervised, or semi-supervised, depending on the level of human involvement in the training process.

50. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

Recent Searches

robinhoodturonmatalimcandidatesimportantelinaitinulospampagandapaglalabamalawakgloriapalitancurtainslilikobayaningnangingitngittodaskaybilisyamanbumangonnagtagisaninventionlayuanidiomatanawnapadaansumingitmatigasasiaticsacrificetinitindasalitangpanindangmagnifykuwebaunahincaroltugonfiverrwaiterpinatirapromotemaongelenaanghelbaryokurakotbotanteasthmagranadatiniobingopresyoinantaykikopriestmukachoiipinasyangkinainairconpasigawpatayfrescomakahingiresortamerikaagadgrinstillniligawangamitintransmitidaswalapaghingiklasrumtaasgoshneed,casamasokpakelamhigitparagraphskinakaligligconnectingulamritoleosinapakramdampierfuelremainmoderneteleviewingbatokpopularizeayonabrilmaynilaatdedication,provepakpakdumiretsomulalingscientistitakprobablementeso-calledmatindingmaalogbilhinschoolschavitmoodmalagocomienzandalagagenerationerpupuntagraceactingpicsfiguressumalapangulobumugaproducirbinabaanramonmuligreendesdeprosperdontipinikitpetsastageinternetlayuninonetrueauthorlockdownkartonofteislaworldspeedkingofferharmfultabiinalisipasokarmedresourcesdosformabitawanitinuringletstudiedbreakdadabaketutorialsputinglutuintheirstructurewhethertabatipeditortechnologicalayanandregoogleandysmalluniquefeedbackmalakingiskowinsallowingmagkakaanaknagtitindapakanta-kantasinabinagsisigawalikabukinmakakawawacultivamagbayadpaglalaitsikre,