Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "wonder"

1. How I wonder what you are.

2. How I wonder what you are.

3. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

4. The Angkor Wat temple complex in Cambodia is a magnificent wonder of ancient Khmer architecture.

5. The Colosseum in Rome is a remarkable wonder of ancient Roman architecture.

6. The Easter Island statues, known as Moai, are a mysterious wonder of ancient stone sculptures.

7. The Galapagos Islands are a natural wonder, known for their unique and diverse wildlife.

8. The Grand Canyon is a breathtaking wonder of nature in the United States.

9. The Great Barrier Reef in Australia is a wonder of marine life and coral formations.

10. The Great Wall of China is an impressive wonder of engineering and history.

11. The Machu Picchu ruins in Peru are a mystical wonder of the ancient Inca civilization.

12. The Mount Everest in the Himalayas is a majestic wonder and the highest peak in the world.

13. The Niagara Falls are a breathtaking wonder shared by the United States and Canada.

14. The Northern Lights, also known as Aurora Borealis, are a natural wonder of the world.

15. The Petra archaeological site in Jordan is an extraordinary wonder carved into rock.

16. The Pyramids of Chichen Itza in Mexico are an impressive wonder of Mayan civilization.

17. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

18. The Statue of Liberty in New York is an iconic wonder symbolizing freedom and democracy.

19. The Taj Mahal in India is a magnificent wonder of architecture.

20. Wonder Woman wields a magical lasso and bracelets that can deflect bullets.

Random Sentences

1. Emphasis is often used to highlight important information or ideas.

2. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

3. Naging bahagi siya ng agaw-buhay na rescue mission upang iligtas ang mga tao sa panganib.

4. Saya suka musik. - I like music.

5. In the land of Narnia, four siblings named Peter, Susan, Edmund, and Lucy discover a magical wardrobe.

6. Pantai Tanjung Aan di Lombok adalah pantai yang terkenal dengan pasir putihnya yang halus dan air laut yang tenang.

7. Les médecins et les infirmières sont les professionnels de santé qui s'occupent des patients à l'hôpital.

8. Adik na ako sa larong mobile legends.

9. El estudio de la música ayuda a las personas a desarrollar habilidades importantes, como la creatividad, la concentración y la capacidad de trabajar en equipo

10. En México, el Día de los Enamorados se celebra con una fiesta tradicional llamada el Día del Cariño.

11. Si Rizal ay kilala sa kanyang pagiging makatarungan at pagiging boses ng mga walang tinig sa kanyang panahon.

12. Investing in the stock market can be risky if you don’t do your research.

13. Sa ilalim ng malawak na upuan, nakita ko ang isang mayabong na lumot.

14. Different types of work require different skills, education, and training.

15. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

16. Dedicated teachers inspire and empower their students to reach their full potential.

17. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

18. Maaari bang hawakan ang iyong mga kamay.

19. Busy sa paglalaba si Aling Maria.

20. Muntikan na syang mapahamak.

21. Tahimik ang buong bahay, waring walang tao sa loob.

22. Salamat at hindi siya nawala.

23. Kinakailangan niyang kumilos, umisip ng paraan.

24. At have en sund samvittighed kan hjælpe os med at opretholde gode relationer med andre mennesker.

25. Emphasis is an important component of artistic expression, such as in poetry and music.

26. Kumikinig ang kanyang ulo at nangangalit ang kanyang ngipin.

27. Der kan være aldersbegrænsninger for at deltage i gamblingaktiviteter.

28. Videnskaben er opdelt i flere forskellige discipliner, såsom fysik, kemi, biologi og geologi, og hver disciplin har sin egen metode og fokusområde

29. My grandma called me to wish me a happy birthday.

30. Baket? nagtatakang tanong niya.

31.

32. Ano ho ang nararamdaman niyo?

33. Ang pagtuturo ng mga guro ay nagpapalaganap ng kaalaman at abilidad sa mga mag-aaral.

34. Today, Bruce Lee's legacy continues to be felt around the world

35. Nakaramdam ako ng sakit kaya hinugot ko ang aking kamay upang pumigil.

36. Einstein's intellectual curiosity, creativity, and persistence in the face of challenges serve as a model for aspiring scientists and scholars.

37. Bawal magpakalat ng mga labis na pamahiin dahil ito ay nagdudulot ng takot at kawalan ng kaalaman.

38. The credit card statement showed unauthorized charges, so I reported it to the bank.

39. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

40. Mahilig akong makinig ng music kaya laging nahuhumaling sa mga bagong kanta.

41. Walang huling biyahe sa mangingibig

42. Hindi madaling mahuli ang mailap na pag-asa.

43. El agua es un símbolo de pureza, vida y renovación.

44. Tumagal ng ilang minuto bago natapos ang palabas.

45. Nakuha ko ang aking inaasam na sapatos kaya masayang-masaya ako ngayon.

46. Sa huling pagkakataon ang mga isda ay nagsalita.

47. Sampung minuto na lang bago mag-alas otso.

48. Sira ka talaga.. matulog ka na.

49. Nagkakasayahan sila sa isang panig ng bilangguan

50. La creatividad es esencial para el progreso y el avance en cualquier campo de la vida.

Similar Words

wonders

Recent Searches

wonderalsokagustuhangwaitpinatay1960sspentenergy-coalcruzpigingskillskasamanaturallordhonmarurusingpagsalakaybagkus,usenag-emailtungkodtigilmalapitansalitalilynatinnagtaasweddingpakikipaglabangasolinahanusowinsarbejdsstyrkeexpertmagbigaymaghahabismokingsomnunmagigitinghumalikhapag-kainanwerenagbigaybilangintherespeechesbahagitinangkangpag-akyatnabahalapakelameroneedsnapakaramingjejuputingparatingpaghihingalonagtatrabahomagisipmadadalamabibingikasinggandaincreasesbilugangaabsenthalagamodernutak-biyatravelertandangtandapantalonnapasigawmakasahodhumalofallaconsidercitizensbrindarandyanyou,brieftheirnamanghanakakapagpatibaymalinisendumakyatsinolossigurongayonbatanag-aagawanre-reviewkarangalanalituntuninkaloobangkupasingconnectingmasayang-masayaleadersdarkiyanayonbayabasjuneforeverentrelawahusayisaacprovemakespobrengglobalregularnaisadvancecreditmisamakikipag-duetonaligawminabutihumanosisikatcoaching:galawmariteswasakmini-helicoptermainitkakuwentuhanilanguniversitieshayopvaccinesnamnaminamazonagam-agamporpangungusappublishingindenkinukuhanagbabasamathkababalaghangdon'tnyopinagkakaabalahancharitablemagkabilangmanakbopalawantrajeeyecitepaghalakhakkanoifugaogawadesisyonanrespektiveamericanairportbateryagngadangmamayangbawiancedulatubigmalalimpumapaligidgirlisisingitmahulognahulimagsunogumaasachefnakaraannaglabatssskinahuhumalingansetskamotebandangcelularesespadailalagaynagtutulunganedadsemillaskakahuyankaininnaiisipmakulit