Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "loss"

1. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

2. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

3. Cancer treatment can have side effects, such as nausea, hair loss, and weakened immune system.

4. Hindi dapat magpakalugi sa pagpapautang dahil ito ay nagdudulot ng financial loss.

5. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

6. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

7. Limitations can be physical disabilities, such as hearing or vision loss, or mental health conditions, such as anxiety or depression.

8. The novel's hefty themes of love, loss, and redemption resonated with readers around the world.

9. The patient experienced hair loss as a side effect of chemotherapy for leukemia.

Random Sentences

1. Claro, podemos discutirlo más detalladamente en la reunión.

2. Pinangaralan nila si Tony kung gaano kahalaga ang isang ama

3. En invierno, los días son más cortos y las noches son más largas.

4. Mi aspiración es trabajar en una organización sin fines de lucro para ayudar a las personas necesitadas. (My aspiration is to work for a non-profit organization to help those in need.)

5. Sa mula't mula pa'y itinuring na siya nitong kaaway.

6. Trump implemented various policies during his tenure, including tax cuts, deregulation efforts, and immigration reforms.

7. Kapitbahay ni Armael si Juang malilimutin.

8. Ang mga engineer nagsisilbi upang mag-disenyo at magtayo ng mga imprastraktura para sa publiko.

9. The patient was discharged from the hospital after recovering from pneumonia.

10. She was excited about the free trial, but I warned her that there's no such thing as a free lunch.

11. Nagbigay ako ng tulong sa mga nangangailangan kaya masayang-masaya ako ngayon.

12. Our transport systems-diesel-run railways, steamships, motor vehicles, and aeroplanes-all constantly need natural fuel to keep on moving

13. AI algorithms can be supervised, unsupervised, or semi-supervised, depending on the level of human involvement in the training process.

14. Wala akong pakelam, basta nasa ref ng bahay ko akin!

15. Investors can purchase shares of stocks through a broker or online trading platform.

16. La inversión en la agricultura es importante para apoyar a los agricultores y la producción de alimentos.

17. Nagtatrabaho ako sa Student Center.

18. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

19. Ang Chinese New Year ay nagpapahayag ng pag-asa at pagbabago para sa bagong taon.

20. Namnamin natin ang bawat sandali ng bakasyon.

21. Ang pag-asa ay nagbibigay ng pagkakaisa sa mga tao sa kanilang pangarap at mga layunin sa buhay.

22. You need to pull yourself together and face the reality of the situation.

23. Kinuha naman nya yung isang bote dun sa lamesa kaso.

24. Kung hei fat choi!

25. Nakatayo siya sa gilid ng bangin, waring nag-iisip nang malalim.

26. Nagdulot ng kakulangan sa tubig ang matagal na tagtuyot sa kanilang lugar.

27. In the early days, telephones were connected to a central switchboard, which connected calls manually

28. Dumating siya mula sa Bikol kahapon ng umaga.

29. Promote your book: Once your book is published, it's important to promote it to potential readers

30. He does not waste food.

31. Wala siyang dalang payong, samakatuwid, nabasa siya ng ulan.

32. He has bigger fish to fry

33. Ilan ang computer sa bahay mo?

34. Las labradoras son muy leales y pueden ser grandes compañeros de vida.

35. Omelettes are a popular choice for those following a low-carb or high-protein diet.

36. Algunas serpientes, como la cobra real y la serpiente de cascabel, son conocidas por sus capacidades defensivas y sus venenos letales.

37. Fødslen kan også være en tid til at forbinde med ens partner og skabe en dybere forståelse og respekt for hinanden.

38. Ano ang binibili ni Consuelo?

39. They analyzed web traffic patterns to improve the site's user experience.

40. Sa tulong ng mapa, natukoy namin ang pinakamabilis na ruta patungo sa beach.

41. Tila malungkot siya ngayon, ngunit hindi niya sinasabi kung bakit.

42. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang labanan ang mga hamon sa buhay.

43. Hinila niya ako papalapit sa kanya.

44. Tuwing Chinese New Year, nagtutungo ang mga tao sa mga templo upang magbigay-pugay.

45. The momentum of the economy slowed down due to a global recession.

46. Sa kalawanging medya-agwa niyon ay nakasilong ang iba pang agwador.

47. Some people take April Fool's really seriously, planning elaborate pranks and hoaxes for weeks in advance.

48. Ang mga halaman ay dapat na pinapakain sa regular na may compost o fertilizer upang matiyak na sila ay may sapat na nutrients para sa paglaki

49. Tuwang tuwa siya sa mga palaka, para sa kanya ay nakakaakit ang mga malalaki at bilugang mata ng mga ito.

50. Nasisilaw siya sa araw.

Recent Searches

railwaysnamataytiniklossisinarasalesbagaysundhedspleje,napatigilhonestomapag-asangdustpanmagbubungamaalognapakabilisteleviewingnagsasagotmagtatanimstudiedzoompaanongbiroipinasyangalleturismohanapbuhaychristmascancernakasahodbangkangcelebrabuwayabahay-bahayanmasayamedisinaagricultorespinakamagalingganitocenterinaduonwaterpagluluksalotkamiaskatagalanregulering,genetinungomangangahoykanya-kanyangrenombresinumankabutihanpakilutonagpaalamsiopaobinatangikukumparapromotenaritonagbabakasyondrewkalayaannilolokolikeskidlatforståkolehiyocomunicanpantalongplaysbumaligtadcrecerkapwapalaynagsamalingidtaposbestmakalipasmalagonaglaroevensinumanggusalilutuinsagapmitigatenakaliliyongbitawanrestsparkdumilimrecentlarryleekauntilakadgasmenautomatiskbaduypaglayaskumantamalapadipagpalitbiologiearnpilipinasmakakatakasspindlemakikitapalancahinawakanpitonagdarasalsong-writingbulongkanyangdogsmakaratingpinakidalakumaripasallottedpedroburgerpeppytuwidvideos,punongkahoylaybrarimatangiskedyulpamanhikanbonifaciosasamahanpagkatakotnasunogallowsnamamanghanagbigaynakakapagtakanegosyosumabogdahilanbinabaratincreasetuwingikawnagsalitabuntispabalangcurrentiniindaanyobutiforminilistatulohoneymoonerspandalawahan4thnatalongnabigyaninabutanmagsunogilalagaytinahakpresence,pokernami-misspneumoniapapayamatabangnatigilantiktok,bighanisparebesespinagsikapanpolopinapasayatreatsnakikiapagtataasmumurabangsongspakealamkuwadernofriendskaninongpancitumigtadfitkunwanangingilidpambahaypinadalapeep