Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "loss"

1. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

2. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

3. Cancer treatment can have side effects, such as nausea, hair loss, and weakened immune system.

4. Hindi dapat magpakalugi sa pagpapautang dahil ito ay nagdudulot ng financial loss.

5. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

6. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

7. Limitations can be physical disabilities, such as hearing or vision loss, or mental health conditions, such as anxiety or depression.

8. The novel's hefty themes of love, loss, and redemption resonated with readers around the world.

9. The patient experienced hair loss as a side effect of chemotherapy for leukemia.

Random Sentences

1. Salamat sa alok pero kumain na ako.

2.

3. He has been gardening for hours.

4. Anong bago?

5. A lot of money was donated to the charity, making a significant impact.

6. Motion kan udføres alene eller sammen med andre, såsom i holdtræning eller sportsaktiviteter.

7. Nationalism can be both inclusive and exclusive, depending on the particular vision of the nation.

8. They are cleaning their house.

9. Matapos ang pagtatanghal, bagamat di man lang siya makangiti at makatawa, kitang-kita sa kaniyang mata ang kasiyahan.

10. I have been working on this project for a week.

11. Football is known for its intense rivalries and passionate fan culture.

12. Tumayo ako para tingnan yung itsura ko ngayon.

13. Naglalaway ang mga tao sa pila habang nag-aabang sa paboritong fast food chain.

14. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

15. Nanginginig ito sa sobrang takot.

16. Kailangan nating mag-ingat sa kalusugan upang maiwasan ang mga sakit, samakatuwid.

17. The Tesla Roadster, introduced in 2008, was the first electric sports car produced by the company.

18. She is drawing a picture.

19. Nakatulog ako sa klase at nagitla ako nang biglang sumigaw ang guro sa aking tenga.

20. Sa mga pinagdadaanan natin sa buhay, kailangan nating maging handa sa agaw-buhay na mga pagkakataon.

21. Ang mga tao ay pumili ng panibagong Sultan at kinalimutan na si Sultan Barabas.

22. The students are studying for their exams.

23. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

24. Ada juga tradisi memotong tali pusar setelah kelahiran, yang dianggap sebagai tindakan penting untuk menjaga kesehatan bayi.

25. Uh huh, are you wishing for something?

26. Women have been subject to violence and abuse, including domestic violence and sexual assault.

27. Naku hindi na po. Ayos lang po ako.

28. Nangyari ang isang insidente na nagdulot ng takot sa kanya, kaya't nais niyang maglimot na lang tungkol sa pangyayaring iyon.

29. Sasagot na sana ulit ako nang lumabas ng CR si Maico.

30. La música es una forma de arte universal que se ha practicado en todas las culturas desde tiempos ancestrales

31. Ang biograpo ay nagsusulat ng mga kwento ng buhay ng mga kilalang personalidad.

32. All these years, I have been learning to appreciate the present moment and not take life for granted.

33. El arte callejero es una forma popular de arte urbano.

34. TikTok has faced controversy over its data privacy policies and potential security risks.

35. Ano ang pinapakinggan mo sa radyo?

36. Hindi mo matitiis ang mga maarteng tao dahil sobrang pihikan sila.

37. He's always the first one in the office because he believes in the early bird gets the worm.

38. Bumisita ako sa lola ko noong Mayo.

39. Hinawakan ko na lang yung pisngi niya. Matulog na tayo.

40. Tila uulan ngayong hapon dahil sa madilim na ulap sa langit.

41. The Mount Everest in the Himalayas is a majestic wonder and the highest peak in the world.

42. Huwag magmadali, namnamin mo ang proseso ng pagkatuto.

43. Kumain ako sa kapeterya kaninang tanghali.

44. Sa isang linggo ay pupunta kami sa Japan.

45. Let's just hope na magwork out itong idea ni Memo.

46. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

47. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

48. Elektronisk udstyr kan hjælpe med at automatisere opgaver og reducere fejl.

49. Ang mga estudyante ay bumalik na sa kanilang mga dormitoryo sa hatinggabi.

50. Wala naman. I think she likes you. Obvious naman di ba?

Recent Searches

supremeblazinglapitanbeganlossclassroomnamenuclearpaslitharmfulheimainitcommunicationtripmapakalipasokprofessionalhandamitcoatlulusogoutpostcebumapaikotsinongcuentanpowerwidespreadmajordrayberduriipinabalikkaringhamakoliviafakebienjacepaypracticesoffentliginvolveinternalissuesdigitalmakesknowimagingelectronicpossibletelevisedislabornpromotingsedentarydecisionsclassessyncstringprogramsactorspreadaffectstructurethirdmethodspackagingryanayanheftynilulonsementobesespangungutyaautomaticadaptabilityinaapimagkahawaksilapaghangahahatolkananumiibigstorytaximahabolhinanakitagilapupuntahanatensyonkombinationfatherpagsisisisnaclockmurangsaidbarrierspasanditoumiinitpalagingtsaatransparentiinuminaddingactingaudittogetherpasswordellencountlessmagkakaanaknagpakitanapakagandangmarahilbodegapaglalayagmusicianmagpalibredalagahumayoprimerasconocidoskagandahanmbaloraisedmaratingtakeexpectationsmagkakaroonbumangonmatiwasaybiocombustiblesmagbagong-anyonapakahusaypapagalitanmaihaharapmaskarapakakasalancommercialunconventionalsiemprepaketepinigilankundimangumagalaw-galawmagtatagalformatnakaliliyongmagsasalitakategori,pagluluksadingginewansasayawinmakangitinakahigangmakakawawapapanhiknakapagsabinagpipikniknag-iinomtiniradornamulatnakakasamanakatayonakumbinsimagkakailalumalakipagpasensyahanmanlalakbaymarketplacespare-parehonagliliyabpagpapatubomakapangyarihangnaglalatangnanghahapdimagsalitanakaupomakuhangbayawakkusinerotumagalkumikilosmagulayawdiscipliner,presence,nanlakiiwinasiwasmakasilongnagreklamomagpapagupitinasikasopinagkiskissaritanakuhangminu-minutonasasabihan