Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "fuel"

1. Dedication is the fuel that keeps us motivated, focused, and committed to achieving our aspirations.

2. Electric cars have lower fuel costs than gasoline-powered cars since electricity is generally cheaper than gasoline.

3. La esperanza es el combustible que nos impulsa a seguir adelante cuando todo parece perdido. (Hope is the fuel that drives us forward when all seems lost.)

4. Our transport systems-diesel-run railways, steamships, motor vehicles, and aeroplanes-all constantly need natural fuel to keep on moving

Random Sentences

1. The scientific community is constantly seeking to expand our understanding of the universe.

2. Nagkakamali tayo sapagkat tayo ay tao lamang.

3. Biglaan ang pag-ulan kanina kaya ako ay nabasa nang husto.

4. Kanino ka nagpatulong sa homework mo?

5. Ano namang naiisip mo? tanong ko sa mapag-asang tono.

6. En tung samvittighed kan nogle gange være et tegn på, at vi har brug for at revidere vores adfærd eller beslutninger.

7. Ano ang pangalan ng hotel ni Mr. Cruz?

8. Las plantas son seres vivos que realizan la fotosíntesis para obtener energía.

9. Sa mga tabing-dagat, naglipana ang mga maliliit na kabahayan.

10. Børn har brug for tryghed, kærlighed og omsorg for at udvikle sig optimalt.

11. All these years, I have been reminded of the importance of love, kindness, and compassion.

12. La realidad es que nunca sabemos lo que nos depara el futuro.

13. Tomar decisiones basadas en nuestra conciencia puede ser difícil, pero a menudo es la mejor opción.

14. Marahil ay hindi pa ito ang tamang panahon upang magpakasal.

15. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

16. Waring pamilyar sa akin ang lalaking iyon, ngunit hindi ko maalala kung saan kami nagkita.

17. Nagpuntahan ang mga tao roon at hinukay ang ugat ng puno.

18.

19. Mabuhay ang bagong bayani!

20. Retweeting is a feature that allows users to share others' tweets with their own followers.

21. Sa muling pagtuturo ng relihiyon, natutunan ng mga bata ang konsepto ng purgatoryo.

22. Hindi ko sinasang-ayunan ang kanilang ideya kaya ako ay tumututol.

23. Nous avons décidé de nous marier cet été.

24. Inakalang hindi na darating ang bus, kaya naglakad na lamang sila.

25. Paano ako pupunta sa Intramuros?

26. Nais naming makita ang mga balyena sa malapit na karagatan.

27. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

28. Anong oras sila umalis sa Camp Crame?

29. Hindi pinakinggan ng Ada ang abuhing Buto ng Kasoy.

30. Hinimas-himas niya yung likod ko pagkalapit niya saken.

31. Les personnes âgées peuvent être bénéfiques pour la société en partageant leur expérience et leur sagesse.

32. Antes de irme, quiero decirte que te cuídes mucho mientras estoy fuera.

33. Después de hacer la compra en el supermercado, fui a casa.

34. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

35. Kebahagiaan bisa ditemukan dalam momen-momen kecil sehari-hari.

36. The policeman directed the flow of traffic during the parade.

37. Magsusunuran nang manukso ang iba pang agwador.

38. Mabait ang dentista na naglinis ng aking ngipin.

39. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

40. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

41. Las drogas pueden alterar el estado de ánimo y la percepción de la realidad.

42. Hindi ako pumayag na hiramin ang aking laptop sa aking kapatid dahil baka masira ito.

43. Hindi niya tinapos ang kanyang proyekto sa tamang oras, samakatuwid, hindi siya nakasali sa kompetisyon.

44. Ngunit sa lahat, siya ang may pinakalutang na kagandahan.

45. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

46. La belleza natural de la cascada es sublime, con su agua cristalina y sonidos relajantes.

47. Sa tabing-dagat, natatanaw ko ang mga isda na lumilutang sa malinaw na tubig.

48. Bago pa man maghatinggabi ay dumating nga ang prinsipe at lubos na nalugod ang nag-aalalang prinsesa.

49. Nasa ganito siyang kalagayan nang bigla niyang maramdaman ang isang ubos-lakas na sipa sa kanyang pigi.

50. L'argent est un élément essentiel de notre vie quotidienne.

Recent Searches

roomfuelwaribilugangexcusebumigayindiatillwithoutkaugnayanpsssfatalimpitfacereleasedlayout,babaexpectationsyearprovechamberschoicethennapakotuyonghinawakannagbiyayaanibersaryokinagagalakmerlindanakapagreklamosponsorships,pinagtagpomatumalnakauslinginagawnaliligovideosfestivalessagasaannakaririmarimtinutopfur1787kargangnakasharknicoinspireatensyonkumustanilayuanmakisuyosunud-sunodguidesambitactorkasinggandaconnectionprospermoreearnsumusunoumingitmagnakawnagtrabahonapasigawmagta-trabahomakapangyarihangpakistancampaignsrektanggulonahigitanwinstumatanglawpootmulighedermataposmatikmanpatiencebagaymatapangmapapabumabaetoyanmaitimreservationfrogexplainsofareadingdownnakumbinsikasalukuyankinikitapagtangisnaapektuhanhampaslupalaruinlumiitkinalilibingantahananligaligmayamangairplanesvetolagunaknight00amkabosesbotanteindividualkablankainsenatepalagingnucleareksaytedkumaripasmatagalkalabawmagpa-ospitalpinapakiramdamanpagkakatayonakatitigsanaypasyalannagpagawamalumbayresponsiblelawsmagkasing-edadmaaariunitedtwinklemaipagpatuloycombatirlas,tinangkangeverythingmentaltayongdumarayonaturalmasasamang-loobcomputeredullfigurepookampliamuntikanmalasmagalingnakabulagtanginabotamericanbingbinglumangoylumalakimainitnakonsiyensyapagnanasapinaghalohabilidadespumulothumalakhakinuminmahahanayemocionanteerlindacomeyumabangpambatangbayawaknandayaduwendematangumpaytumikimmagdaraospagkakataongsayasisipainnapasukokakayananidea:angaluntimelyenerokahusayanimbesbroadcasttodayreserveshomessnalcdcleargamesstudenteasier