Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "morena"

1. Ang ibig Sabihin ng morena ay hindi maitim hindi maputi

Random Sentences

1. Ang aking Maestra ay napakabait.

2. Les patients sont souvent mis sous traitement médicamenteux pendant leur hospitalisation.

3. Ang panayam sa radyo ay ukol kay Doktor Jose Rizal na tumulong sa mahihirap.

4. Malamang na tamaan ka pa ng kidlat.

5. Sa aming barangay, ipinamalas namin ang bayanihan sa pagtatayo ng bagong silid-aralan.

6. Ano ang sinabi ni Antonio Tinio?

7. Namnamin natin ang bawat sandali ng bakasyon.

8. Scissors can be stored in a scissor case or stand to keep them organized and easily accessible.

9. Bumili si Andoy ng sampaguita.

10. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

11. Forældre har ansvaret for at give deres børn en tryg og sund opvækst.

12. He has been hiking in the mountains for two days.

13. Las serpientes son animales de sangre fría, lo que significa que dependen del ambiente para regular su temperatura corporal.

14. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

15. Marurusing ngunit mapuputi.

16. Mathematical concepts, such as fractions and decimals, are used in daily life, such as cooking and shopping.

17. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

18. Ang pamilya ang siyang nagbibigay ng kalinga sa bawat isa.

19. Pupunta kami sa Laguna sa makalawa.

20. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

21. Les patients peuvent être transférés dans des unités de soins spécialisées en fonction de leur état de santé.

22. She was feeling tired, and therefore decided to go to bed early.

23. Siya ay maramot sa pagbibigay ng tulong kahit marami siyang pera.

24. All these years, I have been working hard to achieve my dreams.

25. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

26. Hvert fødsel er unik og kan have forskellige udfordringer og glæder.

27. Magpapabakuna ako bukas.

28. The website has a section where users can leave feedback and suggestions, which is great for improving the site.

29. Maaga kaming nakarating sa aming pupuntahan.

30. Ang kanyang natatanging abilidad sa musika ay nagdala sa kanya sa internasyonal na kasikatan.

31. Representatives are individuals chosen or elected to act on behalf of a larger group or constituency.

32. No te alejes de la realidad.

33. The COVID-19 pandemic has brought widespread attention to the impact of viruses on global health and the need for effective treatments and vaccines.

34. Naman! Alam niyo yung feeling na alam kong siya na talaga?

35. La labradora de mi amigo es muy valiente y no le teme a nada.

36. Gabi na natapos ang prusisyon.

37. Hindi kita puwedeng iwan dahil mahal kita.

38. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

39. He sought to strengthen border security and pushed for the construction of a border wall between the United States and Mexico.

40. Mayroon pa ho sana akong gustong itanong.

41. Yari sa kahoy ang sahig ng bahay ko.

42. Inflation kann auch durch eine Verringerung der öffentlichen Investitionen verurs

43. Det er vigtigt at respektere og anerkende transkønnede personers kønsidentitet og bruge deres præfererede pronominer og navne.

44. Mahalaga rin ang pagkakaroon ng kooperasyon at pagtutulungan upang malutas ang mga palaisipan sa isang grupo o komunidad.

45. Cheating is a breach of trust and often a violation of the expectations and commitments of a relationship.

46. Der er mange traditionelle ritualer og ceremonier forbundet med at blive kvinde i forskellige kulturer.

47. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

48. Tantangan hidup dapat menguji kemampuan dan ketangguhan seseorang, membantu kita mengenal diri sendiri dengan lebih baik.

49. Some critics argue that television has a negative impact on children, as it can lead to decreased attention spans and a lack of physical activity

50. Ibinigay ko ang aking karanasan upang matulungan ang aking mga kababayan na nangangailangan ng tulong.

Recent Searches

morenahallnitongloriformaskaringmapuputiplacesufferbansafakepasliteveningharmfulmulti-billionlangrichabstainingfansenchantedninaiskatotohanancorrectingeverytelevisedbinabaclientesventafeelingpopulationbroadbeingkambingmahirapbigasprogramsprogrammingsystemseparationbroadcastingnegativerepresentedhapdicocktailproducerernasamagbabakasyonnagkantahanenergiincidencenagkitafollowing,dadalawinpinagbigyansumakaykatuwaanpagkasabilumamangmagtigillookedtoyhundredanihinpanginoonhappenedlegacysinulidbroadcastsyanfutureelectedpagbabagong-anyolabiskaraokenagtatakboenglandmadalingtelangnalugisobranagtatamponanigassalbahengyeslibrogigisingnalalaglagcashlakikalabanpagdudugolivescommercekesosumisidkabuntisantumatawaestateaffiliatenaputoltobaccomag-ibanagkapilatnakaka-inpagkakamaliartistasganangsignalpinakamatapatnapakahangapabalanglagaslasnasiyahanrevolutioneretnawalangnaguguluhanparaangpacecomputersmawawalanandayamumuntingmagkakaroonexhaustionmagkamaliplatformstumirapaciencianakakatandakalakimalapalasyoarbularyobalahiboengkantadangpagbabayadmagbalikpamasahesigawlovebulongbumahapakukuluankommunikererhouseholdbuwenaspooreralwaysliligawanawitanpagmasdansinobihirangdepartmenttig-bebeintesementohumigakanilaebidensyauwakhihigitnatitiranggusaliguardanakukulilibumabalotutosamendmentssadyangmaalwangpatpatkumustaandoyforskelganunmeronvetoginaganoonlazadaproductstigasmayamanggrammarcanteenbairdisip00amlendingamerikabinatakcosechasilocosmakaticausesmatarayleytelargerhalamantenderchessminuto