Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "allowing"

1. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

2. Digital microscopes can capture images and video of small objects, allowing for easy sharing and analysis.

3. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

4. Hashtags play a significant role on Instagram, allowing users to discover content related to specific topics or trends.

5. Instagram also offers the option to send direct messages to other users, allowing for private conversations.

6. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

7. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

8. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

9. Microscopes are important tools for medical diagnosis and treatment, allowing doctors to examine cells and tissues for abnormalities.

10. Microscopes can be used to study living organisms in real-time, allowing researchers to observe biological processes as they occur.

11. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

12. Tesla's vehicles are equipped with over-the-air software updates, allowing for continuous improvements and new features to be added remotely.

13. The act of forgiveness requires empathy and understanding, allowing us to see beyond someone's mistakes and recognize their humanity.

14. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

15. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

16. The Tesla Supercharger network provides fast charging infrastructure for Tesla owners, allowing them to travel long distances with ease.

17. Triggering is a key feature of oscilloscopes, allowing users to stabilize and synchronize waveforms.

18. Twitter Moments are collections of tweets and media about specific events or stories, allowing users to catch up on important discussions.

Random Sentences

1. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

2. Los héroes pueden ser aquellos que defienden los derechos humanos y luchan contra la opresión.

3. Landet er et af de førende lande i verden inden for økologisk landbrug, og det er også et af de førende lande inden for vedvarende energi

4. Les hôpitaux peuvent être surchargés en période de crise sanitaire.

5. Hindi dapat natin husgahan agad ang mga taong bukas palad sa kanilang buhay dahil baka sila pa ang tunay na maligaya.

6. Bumili ako niyan para kay Rosa.

7. In the dark blue sky you keep

8. Nag hiking kami sa Mt. Makiling.

9. Pinangunahan ni Emilio Aguinaldo ang proklamasyon ng kasarinlan ng Pilipinas noong Hunyo 12, 1898.

10. The patient's doctor recommended a treatment plan based on the type and severity of their leukemia.

11. Ada banyak kitab suci yang berisi doa-doa, seperti Al-Qur'an, Injil, dan Weda.

12. Napakarami niyang natutunan sa workshop, samakatuwid, handa na siyang gamitin ito sa trabaho.

13. Ang kanilang pagmamahalan ay animo'y walang hangganan, kahit sa anong pagsubok na dumaan.

14. Ang taong may takot sa Diyos, ay hindi natatakot sa mga tao.

15. Maya-maya lang, nagreply agad siya.

16. Nasa kanluran ang Negros Occidental.

17. I received a lot of happy birthday messages on social media, which made me feel loved.

18. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga mapanganib na mikrobyo sa mga kalsada at iba pang mga lugar.

19. Magpapakabait napo ako, peksman.

20. Ang doktor ay pinagpalaluan ng kanyang mga pasyente dahil sa kanyang husay sa pagpapagaling.

21. She admires the philanthropy work of the famous billionaire.

22. Ang obra maestra ay gawa ng mga tao na mayrroong malawak na imahinasyon

23. Walang mangyayari satin kung hindi tayo kikilos.

24. The Tortoise and the Hare teaches a valuable lesson about perseverance and not underestimating others.

25. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

26. La realidad a veces es cruel, pero debemos enfrentarla con valentía.

27. Samahan mo muna ako kahit saglit.

28. I can't access the website because it's blocked by my firewall.

29. Ok lang ba to? Baka naman magalit si Abi.

30. Have they made a decision yet?

31. He also believed that martial arts should be used for self-defense and not for violence or aggression

32. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

33. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

34. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

35. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

36. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

37. Si Hidilyn Diaz ay nag-ensayo sa Malaysia bago sumabak sa Tokyo Olympics.

38. Sa kabila ng mahigpit na bantay, nangahas silang tumakas mula sa kampo.

39. Los remedios naturales, como el té de jengibre y la miel, también pueden ayudar a aliviar la tos.

40. La publicidad en línea ha permitido a las empresas llegar a un público más amplio.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Inakalang magaling na siya sa sakit, pero bumalik ang mga sintomas.

43. Pagkakataon na ni Ogor upang sumahod.

44. Det kan omfatte spil som kasinospil, lotteri, sportsbetting og online spil.

45. Tila hindi siya kumbinsido sa iyong paliwanag.

46. Las plantas con flores se reproducen a través de la polinización, en la que los insectos u otros agentes transportan el polen.

47. Det har også ændret måden, vi planlægger og styrer vores transport, såsom selvkørende biler og flyvemaskiner med automatisk navigation

48. Ang pagkamatay ni Rizal ay naging simbolo ng paglaban sa kolonyalismo at pampulitikang opresyon sa Pilipinas.

49. Saan naman? Sa sine o DVD na lang? tanong ko.

50. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

Recent Searches

magsusunuranpublishingallowingapoyshareintroductionninaiskasalanankawalannapakahangadustpanalinabut-abotthroughoutsetsbinabaliknapipilitanpumikitipapahingamulatungkoddeletingpinalutoberkeleymaalognapakabilissubalitnagpakunothellobiggestprogramming,generatedprimerpa-dayagonalwifieasierdinalaambagnagpasamaataqueslatestnagtuturoklimadahiltanyaggumagamitnamnaminspenttravelerisinalaysaykasoynilalangnagsusulatjeepneynapapasayaterminohitatransportmidlermasayanalungkotteleviewingsakinrenombrekuryentepakpakunahinkailanmanshapingmaipantawid-gutompaskooutlinepangarapginilinglikodkantokahongopportunityscientificpinakamahabanatatawakaraokeprimerasshowermamalasnalamancitizenspare-parehobansanggiverstrengthwealthnoopagsayadbilibinaasahangvarietystyrerfeedbackmasterbangnasundomauliniganbukakamustaconvey,durianvisualpronounsnamatangospatakasiconicpinakamagalingmembersimbeskainissusulitmatakawchildrennakuhangpanghihiyangsaan-saanpinatiranaiilangkinauupuangnatulogmalalakimagpalibrebulakalakturonadditionbungaddurassakitandregoalsumisidemocioneshinihilingevendumiretsoattentionmagkaibangnakaluhodcoughingpaidpagkamulatkinakawitannamissmaipapamanauulitintirantestevetinahakbumibitiwnagsusulputancannilinismahalintiradoryumanigdiretsoandyanbandangcablemillionspositionermakatatloanjotopicwonderngipingsawanagwaginapalakaspananghaliansopasnatataposnapaiyakfriecompaniesmini-helicoptercuredcoursespanatagbuksanhalikanakakapasokundeniablenapigilanmasayang-masayangmatutongnatulakdatingbumangonhimnormalanumangenerateleksiyon