Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "allowing"

1. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

2. Digital microscopes can capture images and video of small objects, allowing for easy sharing and analysis.

3. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

4. Hashtags play a significant role on Instagram, allowing users to discover content related to specific topics or trends.

5. Instagram also offers the option to send direct messages to other users, allowing for private conversations.

6. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

7. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

8. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

9. Microscopes are important tools for medical diagnosis and treatment, allowing doctors to examine cells and tissues for abnormalities.

10. Microscopes can be used to study living organisms in real-time, allowing researchers to observe biological processes as they occur.

11. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

12. Tesla's vehicles are equipped with over-the-air software updates, allowing for continuous improvements and new features to be added remotely.

13. The act of forgiveness requires empathy and understanding, allowing us to see beyond someone's mistakes and recognize their humanity.

14. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

15. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

16. The Tesla Supercharger network provides fast charging infrastructure for Tesla owners, allowing them to travel long distances with ease.

17. Triggering is a key feature of oscilloscopes, allowing users to stabilize and synchronize waveforms.

18. Twitter Moments are collections of tweets and media about specific events or stories, allowing users to catch up on important discussions.

Random Sentences

1. The sun is setting in the sky.

2. Ang parusang angkop sa suwail na anak ay iginawad.

3. Parang itinulos sa pagkakatayo ang mag-asawa at di malaman ang gagawin.

4. Les maladies chroniques sont souvent liées à des facteurs de risque tels que l'âge, le sexe et l'histoire familiale.

5. Mi sueño es convertirme en un músico famoso. (My dream is to become a famous musician.)

6. Parang ganun na nga babes. Tapos tumawa kami.

7. Nagtaka ang bata sapagkat walang nangyari sa babae; sa halip nakangiti nitong ibinigay ang prutas sa bata na siya namang tinikman din ang bunga.

8. Ehehe. Siya yung boyfriend ko.

9. Naglaro ako ng soccer noong Oktubre.

10. Lumalakad siya ngayon na walang-tiyak na patutunguhan.

11. Sa kanya rin napapatingin ang matatanda.

12. Las hierbas de provenza son una mezcla de distintas hierbas secas, ideales para condimentar platos.

13. Eine hohe Inflation kann das Wirtschaftswachstum verlangsamen oder stoppen.

14. De har gjort det muligt for os at automatisere mange af vores daglige opgaver og øge vores produktivitet

15. The victim's testimony helped to identify the culprit in the assault case.

16. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

17. Ang pag-ulan ay nagpawi ng init at tuyot sa lupa.

18. Hindi dapat magbigay ng halaga sa mga kababawang bagay tulad ng kasikatan o kasikatan ng mga gamit.

19. Sa bawat tagumpay, dapat tayong magpasalamat at magbigay ng pagkilala sa mga taong tumulong sa atin, samakatuwid.

20. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

21. Tendremos que tener paciencia hasta que llegue nuestro turno.

22. Ano hong pitaka? ang sabi ng bata.

23. La agricultura sostenible es una práctica importante para preservar la tierra y el medio ambiente.

24. The acquired assets will give the company a competitive edge.

25. Kailangan natin ng mga kubyertos para makakain ng maayos.

26. Jeg har aldrig følt mig så forelsket før. (I've never felt so in love before.)

27. Let's not make this into a big deal - it's just a storm in a teacup.

28. Palibhasa ay may kritikal na pag-iisip at kaya niyang magbigay ng mga valuable opinions.

29. Hindi pa ako kumakain.

30. Kulay itim ang libro ng kaklase ko.

31. Sa kanyang kaarawan, pinuno niya ang kanyang mesa ng mga masasarap na pagkain kaya't ito ay hitik sa mga putaheng lutong-buong.

32. Kayo ang may kasalanan kung bakit nagkaganito ang buhok ko!

33. They have organized a charity event.

34. Gaano ka kadalas pumunta sa doktor?

35. Ano ang sukat ng paa ni Elena?

36. Maraming daga ang nahuli ng pusa ni Leah.

37. Hindi na niya kaya ang mabibigat na gawain dahil mababa ang kanyang lakas.

38. Bago ang kasal, nagkaruon muna sila ng seremonya kung saan nagmamano siya bilang bahagi ng pamamamanhikan.

39. The Velveteen Rabbit is a heartwarming story about a stuffed toy who becomes real through the love of a child.

40. Omelettes are a popular choice for those following a low-carb or high-protein diet.

41.

42. She is designing a new website.

43. Sa dapit-hapon, madalas kaming magtungo sa park para maglaro ng frisbee.

44. Ikaw ang magnanakaw! Amin yan! Nasa ref ng bahay ko!

45. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

46. Les patients peuvent être hospitalisés pour une durée variable en fonction de leur état de santé.

47. Nasa tabing-dagat ako at nagitla ako nang biglang sumulpot ang isang malaking alon.

48. Magkita po tayo pagbisita ko riyan.

49. Isang bansang malaya ang Pilipinas.

50. Los días soleados de invierno pueden ser fríos pero hermosos, con un cielo azul brillante.

Recent Searches

hjemstedallowingmaya-mayakamalianalamsaringlapisrawalitaptapsinehansakimpagsusulattagpiangkapangyarihanservicespagipaliwanagklimamangahasenduringnegosyoinagutompuwedesusimagagandangsapagkatpinaladtatlongkarapatanmaghilamossamakatwidmagingtalagawatchhitikbakitbestidasumasayawmabutingrosasteachnakapilanggaanoisakalalakihanpangulonagtaaslumakaslumalangoymesaklasepitakamalalapadkaniyalokohinlupangmababangistanyagsampungexperiencespanalangincityniztumalonkinuskosasignaturamagsasalitanasunognakabiladkindsbuung-buolungkotipagpalitparagappamilyasaradomatabangdietroonneedgayunmanipagtimplakuwadernocourtmakuhadilagpooksecarsekutsilyoamuyincoviddagatbinabaratpagkuwanelvissinceinomyorknakatanggaphinapilitnakikisaloarbejdermabihisankalikasankuligligginamitpagkakamalipangungutyasong-writingnagmamaktolculturaresearch,sinimulannagtatanimpigibagkusdisenyongeconomypagkuwapinabayaant-shirtkwenta-kwentanaglipanangnakakatandanagtakaemocionantenandayapahahanapdoble-karanakabibingingkontinentengpaghangasundaloo-onlinenakatindignaglahoandroidskillsnakabaontiemposkirbymanakbounanumangatencuestasnatinagpinauwianipumulotharapanumiibignakabluenakatuonminahansahodsakopnagbabasahelenavegaslumbaypaglayasbinawianlunaskaysatengakainispaggawapnilitdiliginmagdilimpresencelandasalasmatindingtresbaitnunohuwebesoponearkulangbumiliyeytigaspulubipagtuturopopcornindividualweddinglamanpalapitbarosoccerscottishmurangpagewalis