Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "others"

1. Emphasis can be used to persuade and influence others.

2. Forgiveness doesn't mean forgetting or condoning the actions of others; it's about freeing ourselves from the negative emotions that hold us captive.

3. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

4. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

5. His charitable nature inspired others to volunteer at the local shelter.

6. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

7. La esperanza es un regalo que debemos valorar y compartir con los demás. (Hope is a gift that we should cherish and share with others.)

8. Limitations can be self-imposed or imposed by others.

9. Mi aspiración es ayudar a los demás en mi carrera como médico. (My aspiration is to help others in my career as a doctor.)

10. Mi aspiración es ser una persona más compasiva y empática hacia los demás. (My aspiration is to be a more compassionate and empathetic person towards others.)

11. Retweeting is a feature that allows users to share others' tweets with their own followers.

12. She does not gossip about others.

13. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

14. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

15. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

16. Some limitations can be temporary, while others may be permanent.

17. Some people have a sweet tooth and prefer sweet flavors over others.

18. Some people view money as a measure of success and achievement, while others prioritize other values.

19. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

20. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

21. The dedication of mentors and role models can positively influence and shape the lives of others.

22. The intensity of baby fever can vary from person to person, with some feeling a passing longing and others experiencing a persistent and overwhelming desire.

23. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

24. The onset of baby fever can be triggered by various factors, such as seeing a newborn, spending time with young children, or witnessing others in their parenting journey.

25. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

26. The Tortoise and the Hare teaches a valuable lesson about perseverance and not underestimating others.

27. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

28. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

29. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

Random Sentences

1. Football is played with two teams of 11 players each, including one goalkeeper.

2. Hindi mo na kailangan ang magtago't mahiya.

3. Sa sobrang lamig ng tubig, hindi ko magawang salatin ito nang matagal.

4. Maruming babae ang kanyang ina.

5. Marahil ay malamig ang klima sa bundok sa panahon ngayon.

6. Para cosechar la miel, los apicultores deben retirar los panales de la colmena.

7. Pakibigay mo ang mangga sa bata.

8. Binulabog ng malakas na tunog ang katahimikan ng paligid.

9. Yes Sir! natatawa pa ako saka ko binaba yung tawag.

10. Franklin Pierce, the fourteenth president of the United States, served from 1853 to 1857 and was known for his support of the Kansas-Nebraska Act, which contributed to the outbreak of the Civil War.

11. Masarap higupin ang sinigang na may maraming gulay.

12. Bakit lumilipad ang manananggal?

13. People experiencing baby fever may find themselves daydreaming about pregnancy, childbirth, and the joys of raising a child.

14. El discurso del líder produjo un gran entusiasmo entre sus seguidores.

15. The cat was sick, and therefore we had to take it to the vet.

16. Alas-tres kinse na ng hapon.

17. TikTok has become a popular platform for influencers and content creators to build their audience.

18. Musk has been named one of the most influential people in the world by TIME magazine.

19. Kailangan mong matuto ng pagsusuri upang mas maintindihan ang kaibuturan ng isang sitwasyon.

20. Microscopes are used to study cells, microorganisms, tissues, and other small structures.

21. Mahalagang ipaglaban natin ang ating kalayaan sa pamamagitan ng tamang pamamaraan.

22. Maaaring magbigay ng libro ang guro sa akin.

23. Kapag aking sabihing minamahal kita.

24. Ayaw mo ba? tanong niya sa malungkot na tono.

25. The pretty lady at the store helped me find the product I was looking for.

26. Ang pangamba ay hindi dapat iwasan, sa halip ay dapat itong harapin upang maiwasan ang mas malaking panganib.

27. Bagaimana cara memasak nasi yang enak? (What is the recipe for cooking delicious rice?)

28. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

29. Ang pagguhit ay isang paraan upang i-express ang mga emosyon at ideya.

30. Maasim ba o matamis ang mangga?

31. Ilang tao ang pumunta sa libing?

32. Magandang umaga Mrs. Cruz

33. Los powerbanks se han convertido en un accesorio imprescindible para muchas personas que dependen de sus dispositivos electrónicos.

34. Computer vision is another field of AI that focuses on enabling machines to interpret and analyze visual data.

35. Foreclosed properties can be a good option for those who are looking for a fixer-upper project.

36. Sino ang mga pumunta sa party mo?

37. Ang pag-uusap namin ng aking kasintahan ay nagpawi ng aming hindi pagkakaunawaan at nagbigay-daan sa pagkakasunduan.

38. La creatividad es esencial para el progreso y el avance en cualquier campo de la vida.

39. Sino ang kasama niyang nagbakasyon?

40. Doa adalah salah satu bentuk hubungan spiritual yang penting dalam hidup manusia di Indonesia.

41. Wag mong ibaba ang iyong facemask.

42. Salbahe ang pusa niya kung minsan.

43. Hinugot niya ang kanyang puhunan sa bangko upang magtayo ng negosyo.

44. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

45. Bagay na bagay sayo ang suot mong damit.

46. Ha?! Ano ba namang tanong yan! Wala noh!

47.

48. Para relajarme, suelo hacer yoga o meditación como pasatiempo.

49. Bumabaha sa amin tuwing tag-ulan.

50. Sa brainly ako madalas nakakakuha ng ideya.

Similar Words

others,

Recent Searches

othersmahahaliktshirtkaraokehilingnageespadahangenechristmasumiyakmahusayyakappasensiyamesanakatuonkatabingnagngangalangbilibshoppingpagluluksamisusedtonyosuwailganalumamangjuniosiniganggeneratedstringmulingefficientaksidenteninyongmagsaing11pmsynculingmakalingsobrapumuntalumakastinionagniningningbayanihigh-definitionuugud-ugodmagasawangpinagsasabimatutongautomaticautomationmayabangnapakamotpaghuhugaspinag-aralanmoneyprogrammingsinongkakayanangmarketingborndumiipagbilipalmakulangeffektivtsanghastaumangatspeechundeniablebahagieuphoriccallinghoweverstatesmokerprocesoipinatindahantusindvisparatingtahimiktumahimiknanahimikipaliwanagengkantadanaantigsigningspinagmamalakitherapykatawangpagkainisyamansumalanagtalagakapatawaranlondonroonrelotuluyanglibertariangayunpamankatutubotuluyanburmaactingnilangtherebilaonextnapabalitapumayagbinigyangdyankonsyertodangerousassociationnag-iimbitaitinulosdumaramiumibigprogramming,createmahiyanapapalibutannakasabitnagpalutonakakatulongnatingsumusunodskillbaoitinanimkasamaanbabeanimpisngidropshipping,hamaktessseguridadtinikphilippinepaghihirapmagsuotpasahelimitmangingisdangkaramihannagkatinginanbumaligtadnyepamanpagkasabimessagepagsayadjerrypagtutoltripmagpakasalnakabiladnanghihinamadexhaustedsatisfactionkapilingkumpletolibremagpasalamathawakanwalkie-talkiefriesconditioningdawbiggestmuchrobinhoodkinikilalanginaabutannakangisipresence,controversyblueimprovemagalangyukofreepinamalaginagandahansagabalmetodiskdoktorlatestmanggagalingnagkalatmuntinlupaotrasbinabalaryngitisnakauwipula