Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "others"

1. Emphasis can be used to persuade and influence others.

2. Forgiveness doesn't mean forgetting or condoning the actions of others; it's about freeing ourselves from the negative emotions that hold us captive.

3. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

4. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

5. His charitable nature inspired others to volunteer at the local shelter.

6. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

7. La esperanza es un regalo que debemos valorar y compartir con los demás. (Hope is a gift that we should cherish and share with others.)

8. Limitations can be self-imposed or imposed by others.

9. Mi aspiración es ayudar a los demás en mi carrera como médico. (My aspiration is to help others in my career as a doctor.)

10. Mi aspiración es ser una persona más compasiva y empática hacia los demás. (My aspiration is to be a more compassionate and empathetic person towards others.)

11. Retweeting is a feature that allows users to share others' tweets with their own followers.

12. She does not gossip about others.

13. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

14. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

15. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

16. Some limitations can be temporary, while others may be permanent.

17. Some people have a sweet tooth and prefer sweet flavors over others.

18. Some people view money as a measure of success and achievement, while others prioritize other values.

19. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

20. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

21. The dedication of mentors and role models can positively influence and shape the lives of others.

22. The intensity of baby fever can vary from person to person, with some feeling a passing longing and others experiencing a persistent and overwhelming desire.

23. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

24. The onset of baby fever can be triggered by various factors, such as seeing a newborn, spending time with young children, or witnessing others in their parenting journey.

25. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

26. The Tortoise and the Hare teaches a valuable lesson about perseverance and not underestimating others.

27. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

28. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

29. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

Random Sentences

1. Babyens første skrig efter fødslen er en betydningsfuld og livgivende begivenhed.

2. Nagalit ang matanda at pinalayas ang babaeng madungis.

3. Nanalo siya ng sampung libong piso.

4. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

5. Pinili niyang magtungo palayo sa gulo upang makahanap ng katahimikan.

6. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

7. Nasa Pilipinas na si Raymond ngayon.

8. Pagkatapos ng ilang taon, nagulat siya nang makasalubong niya ang dating kaklase na matagal na niyang nakalimutan.

9. Ang suporta ng pamilya ni Carlos Yulo ang naging pundasyon ng kanyang tagumpay.

10. The baby is not crying at the moment.

11. The football field is divided into two halves, with each team playing offense and defense alternately.

12. The Niagara Falls are a breathtaking wonder shared by the United States and Canada.

13. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

14. Cinderella is a tale of a young girl who overcomes adversity with the help of her fairy godmother and a glass slipper.

15. Ang mga tao ay nasiyahan sa nangyari.

16. Many people think they can write a book, but good writers are not a dime a dozen.

17. Mayroon pa ba kayong gustong sabihin?

18. Nakatanggap ng bola si Mark mula sa kanyang lolo bilang regalo.

19. They organized a marathon, with all proceeds going to charitable causes.

20. El ballet clásico es una danza sublime que requiere años de entrenamiento.

21. Bigyan mo ng pera ang kapatid mo.

22. Gusto ko na umuwi ng Pilipinas.

23. Nagpunta si Emilio Aguinaldo sa Hong Kong pagkatapos ng Biak-na-Bato.

24. Hindi niya napigilan ang pagdila sa kanyang labi nang naglalaway siya sa pagkaing inihain sa kanya.

25. All these years, I have been building a life that I am proud of.

26. Good afternoon po. bati ko sa Mommy ni Maico.

27. They go to the gym every evening.

28. Kapag umuulan, hindi puwedeng maglaba ng mga damit sa labas.

29. Sa mga lugar na malapit sa ilog, ang mga punong-kahoy ay nakakatulong sa pagpapabuti ng kalidad ng tubig.

30. La obra del artista produjo reacciones diversas entre los críticos.

31. Ang mahal na ng presyo ng gasolina.

32. Mula sa pagiging simpleng atleta, si Hidilyn Diaz ay naging simbolo ng determinasyon at tagumpay.

33. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

34. Sa kasalukuyan, yumabong ang interes ng mga tao sa pagsasaka ng mga organic na gulay.

35. Anak natin. nakangiti pang sabi niya.

36. Algunos artistas famosos incluyen a Leonardo da Vinci, Pablo Picasso y Frida Kahlo.

37. Si Jeny ay bigong manalo bilang presidente ng kanilang paaralan.

38. Ewan ko apelyido pero basta Memo, kilala ka kasi nya eh.

39. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

40. Ilan ang mga puno sa bakuran ninyo?

41. Pakiluto mo nga ng pancit ang mga bata.

42. Musk has faced criticism over the safety of his companies' products, such as Tesla's Autopilot system.

43. Dalam menghadapi tantangan, penting untuk memiliki dukungan sosial dan lingkungan yang positif.

44. Limitations can be physical, mental, emotional, financial, or social.

45. Museum Nasional di Jakarta adalah museum terbesar di Indonesia yang menampilkan berbagai koleksi sejarah dan budaya Indonesia.

46. The credit union provides better interest rates compared to traditional banks.

47. Marami rin silang mga alagang hayop.

48. Pedro! Ano ang hinihintay mo?

49. Hormonbehandling og kirurgi kan have forskellige risici og bivirkninger, og det er vigtigt for transkønnede personer at konsultere med kvalificerede sundhedspersonale.

50. The doctor advised him to get plenty of rest and fluids to recover from pneumonia.

Similar Words

others,

Recent Searches

otherssadyangdiseasebagamadadalosapagkatmagkasinggandasiponbilibkananlarongkirotpinagiyakmaglalakaddalawagiveharapokaynakasuotanongbasahiniconicmalambingmalumbaytignannag-replyfrescoutilizaleadingfewalagacontestfeedback,ilangrabeelvissalamassestryghedschoolsmatchingalokleyteipagbiliwalismightprovidemapuputimarsoriskrosefertilizerjerryblesscescouldauthorabsmacadamiafeelingpamimilhingkapilinggitanasexampleamounttypesestablishedpuntacausesnalalamanmahiwagakulungannanalopamagatheartkahoyatensyonumiwasbabasahinmaitimpookpagsuboktotooipinahamakestasyonhagdananculturespapalapitgagandakatagalhatinggabiminahandoktorhinabinapagtantobinibilijacemaliniscapitalistpagkamulatsponsorships,pinahalatapagkakatayopagluluksamagsasalitanakaliliyongnagtatampopinapakiramdamannakakadalawpinagtagpopaki-ulitpagkakamalimakakawawainspirasyonpagkakalutoendviderekarununganmensajeskinauupuangmamanhikanpaglinganewpupuntaedukasyonlalabaspagkaawakaklasepasyenteclientesnakakaanimnalakinahihiyangbumibitiwbestfriendnabubuhaysaritamaintindihanmauliniganpagdudugonareklamoiniuwikagubatanperpektingcultivationnangapatdantiyakpropesornasilawbangkangpagbibirodapit-haponmatutongkusinalalokargahanpantalongnanghihinamadpulongkaniyacandidatesnanigasawitinculpritaddictiontagaroonsiladreamsadecuadofederaltelatigassinungalingkalongnaglabananginawabalatandresnecesariosumakaymagisingmanuksolenguajedagatmarmaingcitizens1787pagodattentiongenedipangbigotetenderpakainwalangexamaccederpinyabipolarvideo