Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "others"

1. Emphasis can be used to persuade and influence others.

2. Forgiveness doesn't mean forgetting or condoning the actions of others; it's about freeing ourselves from the negative emotions that hold us captive.

3. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

4. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

5. His charitable nature inspired others to volunteer at the local shelter.

6. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

7. La esperanza es un regalo que debemos valorar y compartir con los demás. (Hope is a gift that we should cherish and share with others.)

8. Limitations can be self-imposed or imposed by others.

9. Mi aspiración es ayudar a los demás en mi carrera como médico. (My aspiration is to help others in my career as a doctor.)

10. Mi aspiración es ser una persona más compasiva y empática hacia los demás. (My aspiration is to be a more compassionate and empathetic person towards others.)

11. Retweeting is a feature that allows users to share others' tweets with their own followers.

12. She does not gossip about others.

13. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

14. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

15. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

16. Some limitations can be temporary, while others may be permanent.

17. Some people have a sweet tooth and prefer sweet flavors over others.

18. Some people view money as a measure of success and achievement, while others prioritize other values.

19. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

20. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

21. The dedication of mentors and role models can positively influence and shape the lives of others.

22. The intensity of baby fever can vary from person to person, with some feeling a passing longing and others experiencing a persistent and overwhelming desire.

23. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

24. The onset of baby fever can be triggered by various factors, such as seeing a newborn, spending time with young children, or witnessing others in their parenting journey.

25. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

26. The Tortoise and the Hare teaches a valuable lesson about perseverance and not underestimating others.

27. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

28. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

29. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

Random Sentences

1. Ang bayang magiliw, perlas ng silanganan.

2. Ang pagmamalabis sa pagsasalita ng masasakit na salita ay maaaring magdulot ng alitan at tensyon sa pamilya.

3. Einstein's legacy continues to inspire scientists and thinkers around the world.

4. Kung kaagaw ko ang lahat, may pag-asa bang makilala ka?

5. ¿Cuántos años tienes?

6. Ang pagkamatay ni Rizal ay naging simbolo ng paglaban sa kolonyalismo at pampulitikang opresyon sa Pilipinas.

7. Nakakasama sila sa pagsasaya.

8. Football is a popular sport for both men and women, with many professional women's leagues around the world.

9. Read books on writing and publishing, it will help you to gain knowledge on the process and best practices

10. Sweetness can be used to mask other flavors and create a more palatable taste.

11. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

12. Maraming tao. Isa pa, baka makita tayo ng girlfriend mo.

13. Bata pa lamang ay kinakitaan ng ito ng husay sa larong chess.

14. Børn bør lære om ansvar og respekt for andre mennesker.

15. I am not reading a book at this time.

16. Pagkatapos ng magandang ani, ang aming hardin ay hitik sa sariwang gulay at prutas.

17. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

18. Fødslen er en tid til at fejre og værdsætte kvinders styrke og mod.

19. Nagngingit-ngit ang bata.

20. Sa paggamit ng mga social media, huwag magpabaya sa privacy at kaligtasan ng mga personal na impormasyon.

21. They have been playing board games all evening.

22. Environmental protection requires a long-term vision and commitment to future generations.

23. Terima kasih. - Thank you.

24. Ano ang ginawa ni Trina noong Pebrero?

25. Dahan-dahang pumapatak ang gabi at unti-unting nagdidilim ang mga kalye sa paligid.

26. Nagluto ng pansit ang nanay niya.

27. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

28. He also believed that martial arts should be used for self-defense and not for violence or aggression

29. Les devises étrangères sont souvent utilisées dans les transactions internationales.

30. Hay miles de especies de serpientes en todo el mundo, con una amplia variedad de tamaños, colores y hábitats.

31. Ngayon lang ako nag mahal ng ganito.

32. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

33. Dun na nga raw pala tayo dumeretso sabi ni Tita Andrea.

34. Madalas na mayroong mga organisasyon na nagsusulong ng kapayapaan at pagtigil ng digmaan.

35. We sang "happy birthday" to my grandma and helped her blow out the candles.

36. Kinuha ko yung CP ko at nai-dial ang number ni Joy.

37. Necesitamos esperar un poco más antes de cosechar las calabazas del jardín.

38. Motion kan også have positive mentale sundhedsmæssige fordele, såsom at reducere stress og forbedre humør og selvværd.

39. Pero gusto ko nang umuwi at magpahinga.

40. Las escuelas pueden ser públicas o privadas, coeducacionales o exclusivas para hombres o mujeres.

41. Matagal nang hindi niya nabanggit ang pangalan ng kaibigan niya, kaya parang naglimot na siya rito.

42. Napakalungkot ng balitang iyan.

43. Ayaw ng Datung paniwalaan ang mga aral na itinuturo sa Katolisismo.

44. Puwede bang makausap si Maria?

45. Ikinakagalit ko ang mga sakim na minahan.

46. I'm sorry, I didn't see your name tag. May I know your name?

47. Omelettes are a popular choice for those following a low-carb or high-protein diet.

48. Sa aming barangay, ipinamalas namin ang bayanihan sa pagtatayo ng bagong silid-aralan.

49. Nagbabaga ang talakayan sa klase habang nagtatalo ang mga mag-aaral tungkol sa isyu.

50. Sumalakay nga ang mga tulisan.

Similar Words

others,

Recent Searches

nangangaralmapmagnifyothersjejukumbinsihinlaruinpamburanegosyantekalaunanpneumonia1980paligsahanipasokscottishituturoatensyondividedsinapakrecibirnumerosasgawingwithoutnuclearaumentarincomedalahamakikinabitilawawardtinatanongtotookalabawnapatawagseefilipinamerlindasapainyodancekatagangmusicalbibisitagovernmentnakikialoansadvertising,gumagalaw-galawnakikitangkuyauhogpowersfencingbilislinggo-linggoinakyatgamitinellenskillnaglulutomakasahodsikate-commerce,saan-saanmalapitanstillradionangapatdantherapeuticsmabutijudicialonlyinterestsnangagsipagkantahanhinabolhumanoseroplanonagbabalahalamangingaypaki-translatematchingsino-sinolalakingisinulatbienmagbibiladiniindaredespagkapasokpakiramdamdesign,pinagdedication,kablannasaanhopematamanpaidpoorermahinamaistapatmayabonghimmadamingnapakatalinosarilinangingilidmaratingtupelonakapuntacalciumalamiddollarreaksiyonnageespadahandvdguroallenalugoddisensyotsuperrespektivekumananformashiningiikinabubuhaypapanhiktmicadaddysinehanbeganbuwanKahilingancrossnagandahanmeresetsreducedmagagamitwallethjemstedcompostelatugonissueskalakingpitumpongbasketanungsinogroceryourdisenyopressibonmaestracountriesnangyarihigh-definitionmostproductslahatkalawakancleansystematiskactionexperiencespilingdingginilingburdenvelfungerendepersistent,ninanaismaihaharapwritecomputereguidancepa-dayagonaldostrycyclemagpa-checkupmagpaliwanagpinalakingdesarrollarnyagrabebio-gas-developingareanagtatanghaliansulatkunwazoogngdetallanartsmananalokubo