Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "others"

1. Emphasis can be used to persuade and influence others.

2. Forgiveness doesn't mean forgetting or condoning the actions of others; it's about freeing ourselves from the negative emotions that hold us captive.

3. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

4. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

5. His charitable nature inspired others to volunteer at the local shelter.

6. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

7. La esperanza es un regalo que debemos valorar y compartir con los demás. (Hope is a gift that we should cherish and share with others.)

8. Limitations can be self-imposed or imposed by others.

9. Mi aspiración es ayudar a los demás en mi carrera como médico. (My aspiration is to help others in my career as a doctor.)

10. Mi aspiración es ser una persona más compasiva y empática hacia los demás. (My aspiration is to be a more compassionate and empathetic person towards others.)

11. Retweeting is a feature that allows users to share others' tweets with their own followers.

12. She does not gossip about others.

13. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

14. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

15. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

16. Some limitations can be temporary, while others may be permanent.

17. Some people have a sweet tooth and prefer sweet flavors over others.

18. Some people view money as a measure of success and achievement, while others prioritize other values.

19. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

20. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

21. The dedication of mentors and role models can positively influence and shape the lives of others.

22. The intensity of baby fever can vary from person to person, with some feeling a passing longing and others experiencing a persistent and overwhelming desire.

23. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

24. The onset of baby fever can be triggered by various factors, such as seeing a newborn, spending time with young children, or witnessing others in their parenting journey.

25. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

26. The Tortoise and the Hare teaches a valuable lesson about perseverance and not underestimating others.

27. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

28. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

29. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

Random Sentences

1. Limitations can be viewed as opportunities for growth and personal development.

2. Dahil sa pagkahapo ay nahiga siya sa lilim ng punung-kahoy para magpahinga.

3. Good Friday is the day when Jesus was crucified and died on the cross, an event that represents the ultimate sacrifice for the forgiveness of sins.

4. Los héroes son reconocidos y celebrados por su valentía y altruismo.

5. Danske møbler er kendt for deres høje kvalitet og eksporteres til mange lande.

6. Pagod na ako, ayaw ko nang maglakad.

7. Hinayaan kong lumabas ang malalim na himutok upang ipahayag ang aking galit.

8. Nagbago ang anyo ng bata.

9. Nang malamang hindi ako makakapunta sa pangarap kong bakasyon, naglabas ako ng malalim na himutok.

10. Salatin mo ang upuan upang matiyak na tuyo ito bago ka umupo.

11. Natuto akong magluto ng masarap na pagkain kaya masayang-masaya ako ngayon.

12. Kailan at saan po kayo ipinanganak?

13. Dahil alam niyang galit na ang kanyang ina ay di na umimik si Pinang.

14. They volunteer at the community center.

15. Lumipat si Carlos Yulo sa Japan upang mas mapalakas ang kanyang training sa gymnastics.

16.

17. Landbrugsprodukter, især mejeriprodukter, er nogle af de mest eksporterede varer fra Danmark.

18. Sa tuwing mag-iisa ako, naiisip ko ang aking mga kaulayaw na nasa aking tabi.

19. Napakamot na lang ng ulo si Kenji.

20. Ang mga tulay sa aming bayan ay tinutukoy bilang mga mayabong na likuran na may bulaklak at mga halaman.

21. At minamadali kong himayin itong bulak.

22. Noong 2019, nanalo si Carlos Yulo ng gintong medalya sa World Artistic Gymnastics Championships.

23. Gusto ni Itay ang maaliwalas na umaga habang umiinom ng kape.

24. Ang pagkakaroon ng magandang asal at ugali ay mahalaga sa bawat relasyon, samakatuwid.

25. The lightweight fabric of the dress made it perfect for summer weather.

26. Sa pamamagitan ng kalayaan, nakakamit natin ang tunay na pagkatao at kakayahan.

27. El parto natural implica dar a luz a través del canal vaginal, mientras que la cesárea es una operación quirúrgica que implica hacer una incisión en el abdomen de la madre.

28. Inilabas ng guro ang kanyang laptop sa silid-aralan upang ipakita ang kanyang mga presentasyon.

29. Sa Sabado ng hapon ang pulong.

30. Sa paligsahan, pumasok sa entablado ang mga kalahok nang limahan.

31. Nagalit ang diwata sa ginawa ng madamot na matanda.

32. Salatin mo ang prutas para malaman kung hinog na ito.

33. Oy saan ka pupunta?! sigaw nya.

34. Bigla, mula sa tubig ay isang babae ang lumutang sa hangin.

35. Børn skal have mulighed for at udtrykke sig og udvikle deres kreative evner.

36. Ang pagpapa-tanggal ng ngipin ay ginagawa kapag hindi na maaring malunasan ang sira nito.

37. Mi sueño es ser un artista exitoso y reconocido. (My dream is to be a successful and recognized artist.)

38. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

39. Once upon a time, in a faraway land, there was a brave little girl named Red Riding Hood.

40. Ikaw nga ang dumukot ng pitaka ko at wala nang iba.

41. Ang pagbisita sa isang silid-pahinga o spa ay nagbibigay sa akin ng isang matiwasay na karanasan ng kalinisan at kaginhawaan.

42. Malaya na si Jerry matapos itong makulong ng limang taon.

43. We have been married for ten years.

44. Pagdating namin dun eh walang tao.

45. Ang hangin sa takipsilim ay malamig at presko.

46. Hindi ko inakala na magkakaroon ako ng ganitong pakiramdam, pero crush kita.

47. Pagkatapos maligo, ang katawan ay nagiging mabango at malinis sa amoy.

48. Grande married Dalton Gomez, a real estate agent, in May 2021 in a private ceremony.

49. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

50. Ano ang kulay ng mga prutas?

Similar Words

others,

Recent Searches

otherspagkalungkotmanghulimulingmusicalesmalamankungbakitannalightipasokheibuung-buovedvarendeunconstitutionalinaabutanpaladisposalkayapinalambotprogressremoteinfluentialshifttrabahokuwadernoiniresetapakikipagbabagwishingnahintakutannapabuntong-hiningamatutulogparaisodiyaryosementongnakatagokarangalanbathalamerchandisehopepakinabanganbiensikatumigtadgustomakapagsabientryltorestnakaliliyongtirangpagluluksaroonkaniyakamiaskonsentrasyonkoreaoutlineskikobiyasfamilykatedralpamandisenyongzebracampaignssumayasuwailhulihankaramihannaabutantonyfriesnalalaglagkalikasanhojasaninagniningningpotaenanasundobiggestmaipapautangbantulotbulaklakmaliwanagtaoshalamangkinagagalaknaiinitangawaburolnagkantahanrenatoapologeticadang1920sanywhymakapangyarihangmatangkadgayunpamanbumahahumihingiiloilopulubinakalockpundidotaga-lupangsunud-sunuranakongpulongmartesnaguguluhangmaglalakadtignangayunmandumilatriyanmagselospahahanapaidipapaputolnasugatannaglulutopossibleexplainrecentbeginningsso-calledtradisyonnakangisingginaganapcuentanmayabangfacebookgovernorsmagbalikgownbihasainabumilimagpasalamatspeedsinabilihinkisapmatasamfundkahilingansaglitdahilnakakapuntaetoballnutrientestinayareassukatalasstreetbagamatnangyaributchawitansmilefilipinaathenalondonbrancher,fuericostillfireworkskapitbahayeditpangalanpaketedadalawinnearniyonnakabulagtangrespektivedeterioratenapatigilna-fundistasyonsiragumisingniyancoursesemocionantecountrieskatuwaanhospitalpanindakumatokthenkommunikererbatoidolbalat