Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "others"

1. Emphasis can be used to persuade and influence others.

2. Forgiveness doesn't mean forgetting or condoning the actions of others; it's about freeing ourselves from the negative emotions that hold us captive.

3. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

4. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

5. His charitable nature inspired others to volunteer at the local shelter.

6. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

7. La esperanza es un regalo que debemos valorar y compartir con los demás. (Hope is a gift that we should cherish and share with others.)

8. Limitations can be self-imposed or imposed by others.

9. Mi aspiración es ayudar a los demás en mi carrera como médico. (My aspiration is to help others in my career as a doctor.)

10. Mi aspiración es ser una persona más compasiva y empática hacia los demás. (My aspiration is to be a more compassionate and empathetic person towards others.)

11. Retweeting is a feature that allows users to share others' tweets with their own followers.

12. She does not gossip about others.

13. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

14. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

15. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

16. Some limitations can be temporary, while others may be permanent.

17. Some people have a sweet tooth and prefer sweet flavors over others.

18. Some people view money as a measure of success and achievement, while others prioritize other values.

19. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

20. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

21. The dedication of mentors and role models can positively influence and shape the lives of others.

22. The intensity of baby fever can vary from person to person, with some feeling a passing longing and others experiencing a persistent and overwhelming desire.

23. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

24. The onset of baby fever can be triggered by various factors, such as seeing a newborn, spending time with young children, or witnessing others in their parenting journey.

25. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

26. The Tortoise and the Hare teaches a valuable lesson about perseverance and not underestimating others.

27. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

28. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

29. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

Random Sentences

1. Ang tubig-ulan ay mahalaga sa pagpapanatili ng kalikasan at pangkabuhayan ng mga tao, kaya't mahalaga na ingatan at pangalaga

2. Ang mga mata niyang banlag ay animo'y laging gulat.

3. The lightweight design of the tent made it easy to set up and take down during camping trips.

4. Si Mabini ay isa sa mga pinakamatatalinong lider sa panahon ng himagsikan sa Pilipinas.

5.

6. Elle aime beaucoup écouter de la musique classique.

7. Mahalaga sa aming angkan ang pagpapakita ng respeto sa nakatatanda.

8. Guten Tag! - Good day!

9. Holy Week markerer også starten på foråret og den nye vækst efter vinteren.

10. Money can take many forms, including cash, bank deposits, and digital currencies.

11. Kung walang panget, walang pagbabasehan ng ganda niyo!

12. Bakit niya gustong magpahaba ng buhok?

13. Juan siempre espera el verano para cosechar frutas del huerto de su abuela.

14. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

15. Les travailleurs peuvent obtenir des avantages supplémentaires tels que des bonus ou des primes pour leur excellent travail.

16. Nagbigay ako ng tulong sa mga nangangailangan kaya masayang-masaya ako ngayon.

17. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

18. Ang pagbibigay ng alay sa mga diwata ng kalikasan ay isang mahalagang ritwal sa kanilang kultura.

19. Ang pagkuha ng sapat na pahinga at tulog ay isang nakagagamot na paraan upang maibalik ang aking enerhiya at sigla.

20. The early bird catches the worm.

21. Then the traveler in the dark

22. Kailangan kong lumakas ang aking loob upang maalis ang aking mga agam-agam sa aking mga pangarap.

23. Nang gabi ngang iyon ay hinintay ni Mariang Maganda ang kanyang iniirog.

24. Masanay na lang po kayo sa kanya.

25. Let's keep things in perspective - this is just a storm in a teacup.

26. Buti naman. Ayoko mahawaan ng kuto eh.

27. Paki-basa po ang kuwento para sa akin.

28. Ininom ni Henry ang kape sa kusina.

29. Samantala sa meeting, nagbibigay siya ng kanyang opinyon ukol sa proyekto.

30. Sang-ayon ako sa kagustuhan mo na magpatuloy sa iyong pag-aaral.

31. Inirapan ko na lang siya saka tumayo.

32. The exchange of rings is a common tradition in many weddings.

33. Mahilig siya sa pag-aaral ng mga klasikong akda ng panitikan.

34. Storm can control the weather, summoning lightning and creating powerful storms.

35. Kukuha lang ako ng first aid kit para jan sa sugat mo.

36. Ano ang naging sakit ng lalaki?

37. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

38. Marami nang nakapaligid sa kanila, mga batang nagtitinda, lalaki at babaing mamimili.

39. Sayang, kamu tahu betapa bahagianya aku bersama kamu. (Darling, you know how happy I am with you.)

40. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

41. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

42. Sa trapiko, ang mga traffic lights at road signs ay mga hudyat na nagbibigay ng tagubilin sa mga motorista.

43. En invierno, los lagos y ríos pueden congelarse, permitiendo actividades como el patinaje sobre hielo.

44. Medarbejdere kan arbejde i forskellige miljøer som kontorer eller fabrikker.

45. Los agricultores trabajan duro para mantener sus cultivos saludables y productivos.

46. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

47. Binentahan ni Mang Jose ng karne si Katie.

48. Ipinagmamalaki ko ang pagiging Pinoy dahil sa mayamang kasaysayan ng ating bansa.

49. Have we seen this movie before?

50. Nagsusulat ako ng aking journal tuwing gabi.

Similar Words

others,

Recent Searches

almacenarothershikingdetespadacommunicationsanglatersumakitdistanciaguitarranagdiretsongumingisinasiyahanunocourtsalu-salomakikipag-duetopalipat-lipatnegosyantesabadongmaglalaropaglalaitnagtutulungannamulatamoynakatayoikinalulungkotnagbababapinabulaantraditionallalimpawisoperativoskasalputinewsorkidyaspapuntanginilabasdiyaryopansolproductiontinanggapjosetapatfionagjortpresencekaraniwangumagacashhinigitherramientabulakeducationvistbukastiniopalaybestdiscoveredtumangoharingkerbdapatcontestisaacsteertarafourdulaspeechmovingknowgenerabaryannamungarecordedpaglayasyeahmagpagupitgandahankalikasanhinahanappasaherocontinuepaki-ulitnakaka-bwisityukonanditosinabimakasilongkabibikahariandaratinglutuinditotoysdamidraft:fallbinilingclockleveragevisualeditorilingginilinggenerositybarung-barongmagandang-magandapagkakapagsalitasino-sinoiniirogbilihinkoryentepatakasvictoriaisasamamagkabilangnagtaposmahusayumikotpantalonmalimitbilerpublished,isdaconsideredpalagingconcernsphysicalfatlabasakohanlibraryestablishedissuescloseposts,simplengfullcontent:psycherepresentativescesviewssalubonggulopandemyamabubuhaydomingawaytumalikodnapakaselosonagpapaigibsaranggolataga-nayonnalungkotubos-lakasnakatunghaypinagtulakannakapangasawanapakagandangcarlosilyamarangyangkatagalansinetsuperself-defenseparehasdesarrollarnandoonlunesnakahainpeksmanpanindadispositivolaruintirahankamiassumusulatlalabhanarbularyohinawakannagreplymeetreservedspendingbugtongscientistso-calledamongofficeconvertidasprocesosore