Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "widespread"

1. A series of earthquakes hit the region, causing widespread damage.

2. The belief in God is widespread throughout human history and has been expressed in various religious traditions.

3. The COVID-19 pandemic has brought widespread attention to the impact of viruses on global health and the need for effective treatments and vaccines.

4. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

5. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

6. The widespread use of the telephone has had a profound impact on society

Random Sentences

1. Napatingin siya sa akin at ngumiti.

2. En mi tiempo libre, aprendo idiomas como pasatiempo y me encanta explorar nuevas culturas.

3. Hayaan mo akong magbayad ng lahat.

4. Effective communication and teamwork are important for a successful and productive work environment.

5. Sa aming eskwelahan, ang mga mag-aaral ay nagtatanim ng mga gulay sa school garden.

6. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

7. Nahintakutan ang lahat at hindi magawang lumaban sa magbabagsik na tulisang-dagat.

8. Oscilloscopes display voltage as a function of time on a graphical screen.

9. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

10. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

11. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

12. Nakasabit ang mga larawan ng mga nangungunang mag-aaral sa silid-aralan upang bigyan ng inspirasyon ang mga bata.

13. Pumunta sila dito noong bakasyon.

14. Gusto ng mga batang maglaro sa parke.

15. Saan siya kumakain ng tanghalian?

16. Noong 2019, nanalo si Carlos Yulo ng gintong medalya sa World Artistic Gymnastics Championships.

17. Marahan niyang inalis sa pagkakakawit ang mga balde.

18. Påskeferien giver også mange mennesker mulighed for at rejse og udforske nye steder.

19. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

20. Sa kanyang pagsasalita, siya ay nagdudumaling ng kanyang mga salita upang maiparating ang kahulugan ng mensahe.

21. Ibinigay ni Ana ang susi kay Sally.

22. Ang karagatan ay malalim at malawak na lugar na puno ng buhay-alon.

23. Este año espero cosechar una buena cantidad de tomates de mi huerto.

24. I absolutely agree with your point of view.

25. Spillene kan også være afhængige af held, dygtighed eller en kombination af begge dele.

26. Napakarami niyang natutunan sa workshop, samakatuwid, handa na siyang gamitin ito sa trabaho.

27. A pesar de su mala reputación, muchas serpientes son inofensivas para los seres humanos y desempeñan un papel crucial en la naturaleza.

28. Les systèmes de recommandation d'intelligence artificielle peuvent aider à recommander des produits et des services aux clients.

29. El conflicto entre los dos países produjo tensiones en toda la región.

30. Patients may experience pain, discomfort, and anxiety during their hospital stay.

31. The patient's family history of leukemia increased their risk of developing the disease.

32. Ang umuulan nang malakas ay binulabog ang mga kalsada at nagdulot ng matinding baha.

33. Nahuli ang magnanakaw ng mga sibilyan at iniharap ito sa mga pulis.

34. Dinala niya ang regalo sa tarangkahan ng bahay ng kaibigan niya.

35. Ang rebolusyon ang tumapos sa pananakop ng mga kastila.

36. Nagmungkahi ang dentista na ipalinis ko na ang aking ngipin.

37. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

38. Eksport af teknologi er en stigende del af den danske eksport.

39. Una conciencia clara nos da la fuerza y la confianza para hacer lo correcto.

40. Don't spill the beans about the project, it's supposed to be a secret.

41. Sa di-kawasa ay dumating ang malungkot na sandali.

42. Las labradoras son conocidas por su energía y su amor por el agua.

43. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

44. Doa adalah upaya komunikasi seseorang dengan Tuhan atau kekuatan yang lebih tinggi.

45. Mayroong dalawang libro ang estudyante.

46. La creatividad nos permite pensar fuera de lo común y encontrar soluciones creativas a los desafíos que enfrentamos.

47. Nagugutom na din ang mga tao sa lugar nila at ang dating mapagbigay na mga tao ay nag-aagawan na.

48. La creatividad es fundamental para el desarrollo de ideas innovadoras.

49. Laughter is the best medicine.

50. Kung anu ano ang kanilang pinag-usapan hanggang sa bigla na lang napabalikwas ang prinsipe na tila ba may tumawag sa kanya.

Recent Searches

widespreadnogensindepagguhitblazingvasquesuminomhimutokcombinedpagluluksatotoongopoactorkinikitajeepneyposporopodcasts,magpalibreenglandkanluranpakaininfriendamericapananakitnanangispigilanahascombatirlas,hinampasopisinamalayabutasgenekarangalanmabaitlever,pinakamagalinginatakereachnatigilanmagkasabaycharismatichistoriahinihintayarghnapaluhahulihanmagbungabecomingcasanakainswimmingnamilipittigaseffektivpangulomaranasanputahenatuwanakatulogbilaonatulakcovidrevolucionadoinaabothunisoonipinabalikpumilidailyhelpedjuicepagpililigayacallermagpagupitapoybilisfrogbumabaiyamotnagagandahansmallexpresanapatnapuingatantumawaomfattendelimatikalwaystinanggalanimoycolorshetagakiniwanbringingsunud-sunodbuwayasagasaanmaaaridulotngingisi-ngisingmedidamalihisiniinomexecutivetrainingkakayananpagkabatamakapagempakesobraharapnagsuotmedievalinvolveuniversitysumarapkare-karepumuntaandamingkumalatmatchingatagiliranmanlalakbaymatulisgitaraexitsignalsutillumulusobinterpretingrelevant11pmmakapilingreturnedtutusincreateimaginationoutlinehateeneroespigasyatapigingnaligawmagbabakasyonmagkanokailangreatfulfillmentmagnifyallottedkahusayanyumaomagagandanggayunpamanhinintaywastelalakenoongskypesikattaximakapangyarihangeskwelahanmahabolbetweenkidlatkomedornaghinalatalentedexplainyumabangpulongnobodykatedralsittingnaglinismakuhanglikeskauntikanannapawidumilimmalapitanmakikipagbabagmakikipaglaropunoliligawanseryosongdireksyonoffentligmonumentotaglagasbawatpakilutoreportmadalingpamilyabusy