Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "arts"

1. Born in San Francisco in 1940, Lee was raised in Hong Kong and began training in martial arts at a young age

2. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

3. He also believed that martial arts should be used for self-defense and not for violence or aggression

4. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

5. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

6. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

7. He was a pioneer in martial arts and fitness and his teachings are still relevant today

8. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

9. He was also a pioneer in the use of strength and conditioning techniques to improve martial arts performance

10. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

11. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

12. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

13. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

14. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

15. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

16. Lee's influence on the martial arts world is undeniable

17. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

18. Scissors are commonly used in various industries, including arts and crafts, sewing, hairdressing, and cooking.

19. Sweetness is an important factor in the culinary arts and food industry.

20. These films helped to introduce martial arts to a global audience and made Lee a household name

21. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

Random Sentences

1. Las plantas anuales completan su ciclo de vida en un solo año, desde la germinación hasta la producción de semillas.

2. Das Gewissen ist unsere innere Stimme, die uns sagt, was richtig und falsch ist.

3. Emphasis is an important component of artistic expression, such as in poetry and music.

4. The acquired assets will give the company a competitive edge.

5. A pesar de su mala reputación, muchas serpientes son inofensivas para los seres humanos y desempeñan un papel crucial en la naturaleza.

6. L'argent est un élément essentiel de notre vie quotidienne.

7. Nagtalaga sila ng mga dibisyon kung saan maninirahan ang bawat hayop.

8. Ang talambuhay ni Emilio Jacinto ay nagpapakita ng kanyang kabataan at ang kanyang kontribusyon sa rebolusyon.

9. Isulat mo ang pangalan mo sa papel.

10.

11. Mula noong nakilala kita, hindi ko maalis sa isip ko na crush kita.

12. At have håb om at gøre en forskel i verden kan føre til store bedrifter.

13. Ang bobo naman ito, di pa nasagutan ang tanong.

14. Nasa gitna ng kagubatan kaya hindi mo maiiwasang humalinghing nang malalim.

15.

16. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

17. The dedication of parents is evident in the love and care they provide for their children.

18. Gusto kong manood ng sine bukas, bagkus magbabasa ako ngayon ng libro.

19. Ngumiti siya at lumapit kay Maico.

20. Hindi dapat gamitin ang credit card nang walang sapat na pag-iingat dahil ito ay nagdudulot ng dagdag na gastos at utang.

21. Siniyasat ni Sangkalan at ng mga tao ang puno.

22.

23. Aling lapis ang pinakamahaba?

24. Los motores de búsqueda nos permiten encontrar información específica en línea.

25. The chest x-ray showed signs of pneumonia in the left lung.

26. Pumasok ako sa isang malaking kuwarto na halos hindi ko makita dahil sa sobrang pagdidilim ng mga ilaw.

27. You can always revise and edit later

28. Hindi siya makapaniwala kaya sinalat niya ang kanyang mukha.

29. AI algorithms can be used to automate tasks and improve efficiency in industries such as manufacturing and logistics.

30. Madilim ang kweba na kanilang pinasok.

31. Nag toothbrush na ako kanina.

32. Maraming tao ang naniniwala sa kakayahan ng albularyo kahit hindi ito lisensyado.

33. Forgiveness doesn't mean forgetting or condoning the actions of others; it's about freeing ourselves from the negative emotions that hold us captive.

34. Hindi mo na kailangan ang magtago't mahiya.

35. La science environnementale étudie les effets de l'activité humaine sur l'environnement.

36. She has been tutoring students for years.

37. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

38. Ang Mabini Bridge ay isang makasaysayang tulay sa Lipa City, Batangas.

39. Kadarating mo pa lamang, Ogor, nais niyang itutol.

40. Ang Mabini Shrine ay matatagpuan sa Talaga, Tanauan, Batangas.

41. Ngunit nagliliyab pa rin ang poot sa kanyang mga mata.

42. Mens nogle mennesker nyder gambling som en hobby eller en form for underholdning, kan det også føre til afhængighed og økonomiske problemer.

43. Las plantas suelen tener raíces, tallos, hojas y flores, cada una con una función específica.

44. The photographer captured the essence of the pretty lady in his portrait.

45. Kina Lana. simpleng sagot ko.

46. Palibhasa ay magaling sa paglutas ng mga problema dahil sa kanyang mga analytical skills.

47. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

48. Lumago ang halaman, yumabong ang sanga hanggang sa ito'y namulaklak at namunga.

49. Ang mga dahon ng bayabas ay nagagamit din sa medisina.

50. Napakagaganda ng lumahok sa beauty pageant.

Similar Words

nagmartsapartscharts

Recent Searches

napatinginbilerartsmainitnaritolikelysiyudadpularabe10thmagbagong-anyonapakagagandatsakapalapitmaasahanisinusuotsorepreviouslyspeechnapahintosumarapdulapronounpagkakatayoscottishreservesmagpapabunotpusingpaaralanlilyknownakakaensmokingdasalmagsunogmakakabalikdumilimjeromeenergideletinggamotflexiblemakaratingpartsdedication,datapwatexplaincontesthomeworkstartedpulongcontinueligayainteracttutusinquicklyrektanggulosagotburolinuulammahirapcleantreatspagkatikimbotenahintakutanplanning,checkshesukristoginawangtinangkamamayadireksyonngumingisipaykahoysquashnag-aasikasoanak-pawisnag-aalayboseskayabangannuevomisteryobrightmatitigasnakiisabutterflymerchandiseatekuliglignaaksidenteibabawgranbinabaratpotentialnagpapaniwalabiyasjosiepaskomanamis-namismakakatakaslamangbranchesentryfull-timemagpa-picturetomalmusalusebabychristmasbatofulfillingbuhayumabogmakatatloactivitytungkodkuwebadadaloyearsnapakaramingkuyagawinkingnagkantahanjobsupuanconocidossamauwakmodernphilosophydifferentkapeteryafuncionesaplicarnagkasakitpartfarentertainmentkasinggandasampungnagtaasgainmanipispamilihannapakoduricitizenanitosakingovernorsjuliettumatanglawmisyunerongvedstarbumugaeksenanatagalanprimerospaglalayagmagkamalidevicesisipmadadalabasahinmagkaharapinalalayanagilitywordkare-karenagwalissasakyanlockdownsensiblemanlalakbaymatuliswalletkakutispangalananbingohayaanempresasduonlot,mensahevirksomheder,bihirangpinapaloestasyonnakuhangmoneyspiritualartistasnasasakupanbirthdaygayunman