Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "arts"

1. Born in San Francisco in 1940, Lee was raised in Hong Kong and began training in martial arts at a young age

2. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

3. He also believed that martial arts should be used for self-defense and not for violence or aggression

4. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

5. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

6. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

7. He was a pioneer in martial arts and fitness and his teachings are still relevant today

8. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

9. He was also a pioneer in the use of strength and conditioning techniques to improve martial arts performance

10. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

11. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

12. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

13. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

14. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

15. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

16. Lee's influence on the martial arts world is undeniable

17. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

18. Scissors are commonly used in various industries, including arts and crafts, sewing, hairdressing, and cooking.

19. Sweetness is an important factor in the culinary arts and food industry.

20. These films helped to introduce martial arts to a global audience and made Lee a household name

21. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

Random Sentences

1. Maaaring magdulot ng stress at takot ang pagpunta sa dentista, ngunit mahalagang malampasan ito upang maiwasan ang malalang dental problem.

2. The Hollywood Bowl is an iconic outdoor amphitheater that hosts concerts and live performances.

3. Gaano katagal ho kung maglalakad ako?

4. Libag ang tawag sa duming kumakapit sa katawan na karaniwang galing sa alikabok

5. The bank approved my credit application for a car loan.

6. Dapat nating igalang ang kalayaan ng bawat isa kahit na mayroong magkaibang paniniwala.

7. Cada año, la cosecha de manzanas en esta región es muy buena.

8. I don't like to make a big deal about my birthday.

9. Hala, gusto mo tissue? Sorry ah, hindi ko alam.

10. Anong ginagawa mo? nagtatakang tanong ko.

11. May nakita ka bang maganda? O kabigha bighani?

12. Smoking cessation can have positive impacts on the environment, as cigarette butts and packaging contribute to litter and environmental pollution.

13. Not only that; but as the population of the world increases, the need for energy will also increase

14. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

15. Marahil ay hindi mo pa nakikita ang bagong pelikulang ito kaya't dapat mo itong abangan.

16. Mahilig akong makinig ng music kaya laging nahuhumaling sa mga bagong kanta.

17. Nagbabaga ang usapan ng mga opisyal sa harap ng media dahil sa kontrobersiya.

18. Pare-pareho talaga kayo mga babaero!

19. En af de vigtigste drivkræfter i den danske økonomi er eksporten

20. Después de la lluvia, el sol sale y el cielo se ve más claro.

21. "Dogs come into our lives to teach us about love and loyalty."

22. Ilalagay ko 'to sa mga action figure na collections ko.

23. Ang umuulan nang malakas ay binulabog ang mga kalsada at nagdulot ng matinding baha.

24. I have a tradition of taking a photo every year on my birthday to document how I've changed over time.

25. Mabilis nyang kinuha ang laptop upang tapusin ang kanyang nobela.

26. The invention of the telephone and the internet has revolutionized the way people communicate with each other

27. Sa bawat salaysay ng nakaligtas, maririnig ang kanilang hinagpis sa trahedya.

28. Effective use of emphasis can enhance the power and impact of communication.

29. Upang hindi makalimot, laging may sticky notes ang malilimutin na si Bea.

30. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

31. Les enseignants peuvent organiser des projets de groupe pour encourager la collaboration et la créativité des élèves.

32. El algodón es un cultivo importante en muchos países africanos.

33. Nakatayo ito sa harap ng isang bilao ng kangkong at sa malas niya ay tumatawad.

34. Isa daw siyang mabangis na hayop dahil tulad nila meron din siyang matatalim na mga pangil.

35. Umiiyak ang kanyang mga magulang ngunit alam nilang wala na silang magawa para sa bata.

36. Dahil sa pagiging maramot, madalang siyang bisitahin ng kanyang mga kaibigan.

37. Pumasok po sa restawran ang tatlong lalaki.

38. Hello? sagot ko agad pagkaangat ko ng receiver.

39. Ah miss, tanong lang... Iyo bang lahat yan?

40. Durante las vacaciones de Semana Santa, asistimos a procesiones religiosas.

41. Me duele la espalda. (My back hurts.)

42. Football is a popular team sport that is played all over the world.

43. Hindi dapat magbase ng pagpili ng mga kaibigan sa kanilang kababawan, kundi sa kanilang pagkatao.

44. Inilabas ng pulisya ang larawan ng salarin upang matulungan ang mga sibilyan na makakilala sa kanya.

45. The acquired assets were key to the company's diversification strategy.

46. Matapos ang kanyang tagumpay, si Hidilyn Diaz ay tumanggap ng maraming parangal mula sa gobyerno at pribadong sektor.

47. The Tesla Supercharger network provides fast charging infrastructure for Tesla owners, allowing them to travel long distances with ease.

48. Sa araw araw na pagkikita ng dalawa ay nahulog na ang loob nila sa isa't-isa

49. Sa Manila Hotel ka titigil, hindi ba?

50. Algunas obras de arte son consideradas obras maestras y son muy valoradas.

Similar Words

nagmartsapartscharts

Recent Searches

workdaymatayogartsagosfeltnapakagandabalotnakisakaynag-aabangstandanibersaryomawawalatuloyvedvarendeadobobinabaansusunod1929isinawaknutsmaintindihanprosesopinalayassinampaleitherpangakothreestruggledmagkaibangbeyondnagpasamabitiwanconnectionrequirelibagcandidatepapuntaitemsencounterremotetwinkleartificialclassmateprocessmagpa-checkuptodomagpaliwanagpageefficientpagkalungkotnagkakakainitinatapatsugatansakristanpalayanandoykahonginaganapopgavermamanhikanioskondisyonedukasyonnakatitignakatinginalenaglinispamumuhaysakoppaglalabamantikabigaynewvisguestslastingnagwelgabaclaranlibrelugawipinikitexhaustedpagdamipracticadonoongnag-iisipsumalamangingisdanglayawganoonbroadcastchristmasmabuhaysumakitcoaching:bilhinpasahemaliitsumalisalesnagtalaganalalaglage-bookseconomicnapatawagpananglawnakadapawestbibisitaprobinsiyagratificante,nakaluhodpodcasts,sistervirksomheder,villagenagtrabahoyouthgumagalaw-galawpakistangayundininspirationtelahinihintaytaksinagpasalamatpaghaharutanellanakakatawaiskolaranganwarigawinmatitigaspahaboldisenyongnobodynapuyatmataposbagyowowsinasabianumangdaysnapabayaanmayabongpasaheroabangankatabingestablishsilbingtulangnapaiyakmaisusuotalokbalitaexplaincomputereandroidfatallumulusobputingnapapahintoguidanceitlogbehavioraffectnapahintoincidencemakapaibabawdumilimworkinggabrieltracksofatakboinatupagnakabawinanaloorderinkinavirksomhederuusapanlondonriyan1980resultpatiencekaratulangnapakahanganakaraanpagkabiglameriendavictoriadamitniyaagwadorespecializadasyumaoperfect