Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "asignatura"

1. Galing sa brainly ang isinagot ko sa asignatura.

2. Nagsasagot ako ng asignatura gamit ang brainly.

Random Sentences

1. The beauty store has a variety of skincare products, from cleansers to moisturizers.

2. Saan ka galing? Dalawang araw na ako dito ah! aniya.

3. Nagdadasal ang mga residente para sa ulan upang matapos na ang tagtuyot.

4. La esperanza es una luz que brilla en la oscuridad, guiándonos hacia un futuro mejor. (Hope is a light that shines in the darkness, guiding us towards a better future.)

5. El powerbank es una solución conveniente para cargar teléfonos móviles, tabletas u otros dispositivos en movimiento.

6.

7. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

8. Gawan ninyo ng paraang makalabas po sana ako sa pagkakakulong ko sa loob ng prutas na ito.

9. Ibinigay niya ang bulaklak sa nanay.

10. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

11. The bakery offers a wide variety of cakes, from classic flavors to unique creations.

12. Umiling lang siya tapos hinawakan yung kamay ko.

13. Ang bobo naman ito, di pa nasagutan ang tanong.

14. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

15. Las serpientes son animales de sangre fría, lo que significa que dependen del ambiente para regular su temperatura corporal.

16.

17. Like a diamond in the sky.

18. Musk has expressed interest in developing a brain-machine interface to help treat neurological conditions.

19. Nandito ako umiibig sayo.

20. Les personnes âgées peuvent bénéficier de services de soins à domicile pour maintenir leur indépendance.

21. Nice meeting you po. automatic na sabi ko.

22. Sa tuwing Undas, bumibisita ang mga pamilya sa sementeryo upang mag-alay ng mga dasal para sa mga yumaong kamag-anak na maaring nasa purgatoryo pa.

23. Skolegang er en vigtig del af børns opvækst og udvikling.

24. Walang makakibo sa mga agwador.

25. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

26. Technology has also had a significant impact on the way we work

27. A wife can be a source of emotional and physical intimacy for her husband.

28. You can't judge a book by its cover.

29. Ano-ano ang mga sangkap ng iyong spaghetti?

30. Gusto ko dumating doon ng umaga.

31. Ganid na sa pera ang mga taong nakaupo sa pwesto.

32. Jennifer Aniston gained fame for her role as Rachel Green on the television show "Friends."

33. Hmmmm! pag-iinat ko as soon as magising ako. Huh?

34. Malaki at mabilis ang eroplano.

35. He preferred a lightweight moisturizer that wouldn't feel heavy on his skin.

36. Have they fixed the issue with the software?

37. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

38. Saka sila naghandang muli upang ipagtanggol ang kanilang bayan.

39. Las redes sociales son una parte fundamental de la cultura digital actual.

40. Masarap mag-surfing sa dapit-hapon dahil mas malamig na ang dagat.

41. Maraming tao ang nagpaplastikan sa harap ng ibang tao para lang mapasama.

42. Me duele la espalda. (My back hurts.)

43. Los héroes son capaces de tomar decisiones difíciles y hacer sacrificios personales en beneficio de los demás.

44. Maraming guro ang nagbigay ng suhestiyon ukol kay Beng.

45. Einstein was awarded the Nobel Prize in Physics in 1921 for his explanation of the photoelectric effect.

46. Stephen Curry revolutionized the game with his exceptional three-point shooting ability.

47. Las hojas de eucalipto se utilizan a menudo para aliviar la congestión nasal.

48. Ipanlinis ninyo ng sahig ang walis.

49. Gusto kong tumakbo at maglaro sa parke.

50. Dun na nga raw pala tayo dumeretso sabi ni Tita Andrea.

Recent Searches

magagamitasignaturapigilanpiyanomagalitvedvarendealagangnatitiyakbusiness:kargahancramelilikodumilatuniversitiesherramientasipinambilikataganghinatidisinaramaluwagkuwentolookedubokingdomkapainnakadisposaloutlinesinekalongnoelsmilesikipawardisinumpaforskelnapilitangnilapitancandidatesagostowaladuonalexander1929parowalongtanoddipangokayumanofe-facebooknararapatmachinesanghelnapapikitamericanhoyphilippineathenaalaymangingisdaschoolsibalikprobablementemaskmasdanmallzoomolivia1980sabihingtelangpakainomelette1876sanorugagreatibigprofessionalcigarettesminutelinefeelsumugodhumanoscoatreservedheartbeateskuwelabubongislameangenerationerprivateharmfulsumapitmatabaeveningtheremichaelstatecomputereuponstuffedgenerateimaginggrabeableprogramming,draft,termpacetypesannapuntanaligawlarawankundimemorialpaligsahanmalakasmunabinililapiscedulapusaaniamountahasgloriadescargarnagkakasyathenpublicationtalagamarangalsinasabisettingparkingcarolnangingisaypagkahapokumatokgurotatawagandekorasyonnakalagaybuung-buoagam-agamnaguguluhangpamamasyalmerlindatinatawagmakikipagbabaghinahanapejecutanpinasalamatancancergumagamithampaslupapagtataasnagmadalingnagawangtalententranceuusapanna-suwaykonsentrasyonanibersaryonaglalatangmagpa-checkupculturakinamumuhianvideos,nakapagngangalitagwadorbarcelonanuevoskanayangjulietcynthiaisinalaysayhinamaktindahanpasaheininomkisamevictoriabintanaadvancementdireksyonmangingisdangpasaheroregulering,nabigyanpropesorkanyamaaliwalaspersonal