Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "emphasis"

1. Effective use of emphasis can enhance the power and impact of communication.

2. Emphasis can also be used to create a sense of urgency or importance.

3. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

4. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

5. Emphasis can be used to create a memorable and impactful message.

6. Emphasis can be used to create a sense of drama or suspense.

7. Emphasis can be used to create rhythm and cadence in language.

8. Emphasis can be used to express emotion and convey meaning.

9. Emphasis can be used to highlight a person's strengths and abilities.

10. Emphasis can be used to persuade and influence others.

11. Emphasis can be used to provide clarity and direction in writing.

12. Emphasis can help clarify and reinforce the meaning of a message.

13. Emphasis can help to ensure that a message is received and understood by the intended audience.

14. Emphasis is an important component of artistic expression, such as in poetry and music.

15. Emphasis is an important tool in public speaking and effective communication.

16. Emphasis is often used in advertising and marketing to draw attention to products or services.

17. Emphasis is often used to highlight important information or ideas.

18. Emphasis is the act of placing greater importance or focus on something.

19. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

20. Over-emphasis can be counterproductive and may undermine the intended message.

21. The use of emphasis is influenced by cultural and social norms.

Random Sentences

1. Tila nagtatampo siya dahil hindi mo siya kinausap kanina.

2. The baby is not crying at the moment.

3. The momentum of the car increased as it went downhill.

4. Mataaas na ang araw nang lumabas si Aling Marta sa bakuran ng kanilang maliit na barung-barong.

5. Bumibili ako ng pagkain sa grocery store.

6. Nasaan ang Katedral ng Maynila?

7. Nag-iisa siya at tulala sa gitna ng kalsada nang makita ko siya kaninang umaga.

8. Twitter chats are organized conversations on specific topics, usually held at designated times using a specific hashtag.

9. Pasasaan ba't di iikli ang pila? naisip niya.

10. Palibhasa ay mahusay sa pagbasa ng mga komplikadong mga aklat at materyales.

11. Ang mga kasiyahan at salu-salo sa hapag-kainan ay nagdudulot ng kasiyahan sa bawat tahanan tuwing Chinese New Year.

12. I finally quit smoking after 30 years - better late than never.

13. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

14. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

15. Está claro que debemos tomar una decisión pronto.

16. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

17. Nagtaka ito sa pagbabagong-anyo ni Kiko hanggang maging maliit na hayop na animo'y bayawak.

18. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

19. Certains pays et juridictions ont des lois qui régulent le jeu pour protéger les joueurs et prévenir la criminalité.

20. Limitations can be viewed as opportunities for growth and personal development.

21. The Tesla Supercharger network provides fast charging infrastructure for Tesla owners, allowing them to travel long distances with ease.

22. Si Anna ay maganda.

23. Ang abilidad sa pangangalaga ng kalusugan ay mahalaga upang mapanatili ang malusog na pamumuhay.

24. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

25. Paano ho ako pupunta sa palengke?

26. Hello. Magandang umaga naman.

27. Hinde ka namin maintindihan.

28. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

29. Ang bituin ay napakaningning.

30. Sa condo ko. nakangiti niya pang sagot.

31. Bago pa man maghatinggabi ay dumating nga ang prinsipe at lubos na nalugod ang nag-aalalang prinsesa.

32. Scientific discoveries have revolutionized our understanding of genetics and DNA.

33. Hindi ako sang-ayon sa mga desisyon ng aking mga magulang tungkol sa aking buhay.

34. Gusto kong manood ng mga pambatang palabas.

35. Walang sinasabi ang mga ito, ngunit sa mga mata, sa galaw ng mga labi nababasa nya ang isinisigaw ng mga paslit.

36. Claro, puedes contar conmigo para lo que necesites.

37. Ang buhangin sa tabing-dagat ay nagbabaga sa init ng araw kaya’t mahirap itong apakan.

38. Ang kundiman ay nagpapaalala sa atin ng mga halaga ng pagmamahalan at pagka-makabayan.

39. Ang pagsusulat ng mga saloobin at damdamin sa pamamagitan ng journaling ay isang nakagagamot na paraan upang maibsan ang aking mga problema.

40. Makikiligo siya sa shower room ng gym.

41. Would you like a slice of cake?

42. Lahat ng tao, bata man o matanda, lalake at babae, ay tumaba.

43. Hinde ko alam kung bakit.

44. Nasa labas ka ba? Teka puntahan kita dyan.

45. Sí, claro que puedo ayudarte con eso.

46. At have et håb om at blive en bedre person kan motivere os til at vokse og udvikle os.

47. Anong gusto mo? pabulong na tanong saken ni Maico.

48. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

49. Mahal na mahal ni Aling Rosa ang kanyang bugtong na anak.

50. If you quit your job in anger, you might burn bridges with your employer and coworkers.

Recent Searches

emphasisbakelever,ledbroadlayuninchefartificialhoweverstuffedalinelectronicrolledpigingmalikotmaibalikinimbitahikinginiibigiskedyulkulotcarloinalagaanplagastibigcarriescoalgumuhitcashnasuklamcovidnangangahoypagkakayakapnagulatsalamangkeropresidentialtinulak-tulaknaglalakadkinamumuhianpinag-usapannapaplastikanpakikipagtagponapakamisteryosowalkie-talkiemagpa-ospitalnangagsipagkantahanmaipantawid-gutomdondenagkasakitnecesariopangungusapnakikitanghandaanumiinombeautyleksiyonmagtiwalamahuhusaylivenagdiretsoh-hoyrailwaysmgauusapannabubuhaynagpepekenakuhangmakahiramdisenyongkaloobangkinauupuangnakakapasokmusiciandropshipping,lumalakisasakaycompanymaynilaatmagsunogmusicalesrektangguloamericakumirotumagawthanksgivingkuryentemauliniganaaisshejecutanwakaspagkattatagalhawakhimayinkaysanabigyansurroundingspapuntangilagaymitigatelasasinehanpulitikokesotomorrowdiaperminamasdanhahahapaulit-ulitmaghaponnagbentanamuhaygospelnagsinena-curiouspinabulaanbihirangsangasagotsandalingngipingumigibbantulotbibilibumagsaksikatnahantadpulisradiodemocracylagifonossangfionabigyanconsumeindustryhugissonidosarilingpupuntafindshapingauditpangulodragonaalisakosusunduinlegislativeespadasaringpinag-aralanuuwiboksingpostcardmayotodopitakabatiadverseterminoisaacsellsantomodernpiecesgayunpamankinuskosnegativeetoauthorhalikaeducationalbadfacilitatingkarnabalputipdamapadalialejoydistansyanextperomukahcallingideamaputisquatterbadingparatingresourcesdigitalarmednothingnagginghimselfrelativelyimprove