Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "emphasis"

1. Effective use of emphasis can enhance the power and impact of communication.

2. Emphasis can also be used to create a sense of urgency or importance.

3. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

4. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

5. Emphasis can be used to create a memorable and impactful message.

6. Emphasis can be used to create a sense of drama or suspense.

7. Emphasis can be used to create rhythm and cadence in language.

8. Emphasis can be used to express emotion and convey meaning.

9. Emphasis can be used to highlight a person's strengths and abilities.

10. Emphasis can be used to persuade and influence others.

11. Emphasis can be used to provide clarity and direction in writing.

12. Emphasis can help clarify and reinforce the meaning of a message.

13. Emphasis can help to ensure that a message is received and understood by the intended audience.

14. Emphasis is an important component of artistic expression, such as in poetry and music.

15. Emphasis is an important tool in public speaking and effective communication.

16. Emphasis is often used in advertising and marketing to draw attention to products or services.

17. Emphasis is often used to highlight important information or ideas.

18. Emphasis is the act of placing greater importance or focus on something.

19. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

20. Over-emphasis can be counterproductive and may undermine the intended message.

21. The use of emphasis is influenced by cultural and social norms.

Random Sentences

1. In the dark blue sky you keep

2. I'm not impressed with his art. Paintings like that are a dime a dozen.

3. Me gusta recolectar hojas secas en el parque y hacer manualidades con ellas.

4. Siya ay kilala sa kanyang abilidad sa pagsusulat ng mga makabuluhang tula.

5. Nasi goreng adalah salah satu hidangan nasional Indonesia yang terkenal di seluruh dunia.

6. Anong oras ako dapat umalis ng bahay?

7. Nakagagamot ng diyabetis ang halamang ito.

8. Lumapit siya sa akin tapos nag smile. Nag bow ako sa kanya.

9. Estoy sudando mucho. (I'm sweating a lot.)

10. Gabi na natapos ang prusisyon.

11. Tomar decisiones que están en línea con nuestra conciencia puede ayudarnos a construir una vida significativa y satisfactoria.

12. Kahapon, nakita ko siyang tulala sa parke nang walang pakialam sa mga taong nasa paligid niya.

13. Anong petsa na? salubong sa akin ni Aya.

14. Sa ganang iyo, tama ba ang desisyong ginawa ng ating gobyerno?

15. By refusing to compromise, she ended up burning bridges with her business partner.

16. Bakit? Dahil ba mahahawa ako sa sakit mo? concern ba sya?

17. Napaluha si Aling Pising nang makita niya ang bunga nito.

18. Waring malungkot siya ngayon, ngunit hindi niya sinasabi kung bakit.

19. Me duele todo el cuerpo. (My whole body hurts.)

20. Ilan po ang lalaking pumasok sa restawan?

21. Napakahusay nga ang bata.

22. Pinagkakaguluhan lamang tayo ng mga tao rito ay wala namang nangyayari.

23. Las labradoras son perros muy fuertes y pueden soportar mucho esfuerzo físico.

24. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

25. Kill two birds with one stone

26. Pagkatapos ng malagim na balita, natagpuan ko ang aking sarili na tulala sa kanyang kwarto.

27. Nagkakamali tayo sapagkat tayo ay tao lamang.

28. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

29. Al usar un powerbank, es importante seguir las instrucciones del fabricante para un uso seguro y adecuado.

30. Ang paggamit ng droga ay hindi lamang nanganganib sa iyong buhay, kundi pati na rin sa buhay ng mga mahal mo sa buhay.

31. Sa mga hayop, ang hudyat ay maaaring gamitin sa pakikipag-ugnayan, tulad ng pagpapakita ng kilos ng buntot o ng mata.

32. Software er også en vigtig del af teknologi

33. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

34. Gusto kong matutong tumugtog ng gitara.

35. AI algorithms can be supervised, unsupervised, or semi-supervised, depending on the level of human involvement in the training process.

36. Alas-tres kinse na ng hapon.

37.

38. Sa pagkawala ng kanilang tahanan, naghihinagpis ang mga pamilyang apektado ng sunog.

39. Algunas personas disfrutan creando música electrónica y mezclando sonidos para crear nuevas canciones.

40. At blive kvinde handler også om at lære at tage vare på sig selv både fysisk og mentalt.

41. Hindi ko alam ang sagot, pero sa ganang iyo, ano ang dapat gawin sa sitwasyong ito?

42. The hotel room had an absolutely stunning view of the city skyline.

43. Gusto ko nang kumain, datapwat wala pa akong pera.

44. Ang mga estudyante ay bumalik na sa kanilang mga dormitoryo sa hatinggabi.

45. La creatividad es clave para el éxito en el mundo del arte y el diseño.

46. Nakakatulong ang paghinga ng malalim at pagsisimula ng halinghing para sa relaxation.

47. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

48. Les personnes âgées peuvent être bénéfiques pour la société en partageant leur expérience et leur sagesse.

49. Napakabagal ng proseso ng pagbabayad ng buwis, animoy lakad pagong.

50. Ang tubig-ulan ay maaaring magdulot ng pagkakasakit kung hindi magiging maingat sa pag-inom nito.

Recent Searches

emphasissedentaryinaasahangdonformatkaragatan,nararamdamantuwahalikstateendbringingo-onlinebumabalothumihingishiftelectpilingilalimmonumentomapahamakmaitimechavenakasahodnagkabungatumatawadmanirahantamisinaasahanmetodiskkaragatanstagemagtakanababalotnagbabagafulfillingiconmasasakitenergiadoptedpilipinasgumagamitdalawangmalawakbiglaangranadanaiwangmagnifysakitharapinsumabogkuwartainaabottangingtawananiniirogdraybernaantiglabananvedvarendenagandahannagtutulakmapagbigaynakauslingkinikilalangkagabitelebisyongagawinmatapangmakikikainmananahimagagawakainitannagdaosfavorlumuwaskolehiyojingjingnakabilikasangkapandesigningmahinangmalaki-lakicoachingdyipexigenteniyogsentencekesonagtapositsurapinabilidiinkapitbahaymahagwaykubyertosuusapanminutokumidlatmag-usapmandirigmangkahoyhomeworkshockmundotaongumulanhanginalas-dosgawainbagyosumuotnagtataaslaruanshinesinvestparusamorenabalotkapintasangnanagtemperaturahabilidadestaon-taonginawabagkinalakihantabinglipadsenadorbikoltaun-taongawingintramurostalagaskabtmassachusettskaratulangtinuturopinakamatabangtodassumasaliwbuwayabutonangangaralearnproblemaweretuladsapatsilapinapakiramdamanstudiedmapagkalingatulisankampeonayangiftskyldes,gustoexpresanmagselosguidemissionvivasuotligafacengangginanapatingalabingimedidabilitaonmaaaringsquatterrevolutionizedpaki-ulittanghalianhoweverputaheleecomparteni-rechargeadverseandamingsincetvsmaarimediumeyerobertcornerbehaviornagdaboglihimkadalagahangjustinanna