Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "four"

1. During his four seasons with the Heat, LeBron won two NBA championships in 2012 and 2013.

2. Grande is renowned for her four-octave vocal range, often compared to Mariah Carey.

3. He has been named NBA Finals MVP four times and has won four regular-season MVP awards.

4. In the land of Narnia, four siblings named Peter, Susan, Edmund, and Lucy discover a magical wardrobe.

5. The President is elected every four years through a process known as the presidential election

Random Sentences

1. Paliparin ang kamalayan.

2. Sino ang kasamang kumanta ni Katie?

3. Kailangan ko ng bumalik sa aming kaharian dahil kung hindi ay hindi na tayo muling magkikita pa.

4. I like how the website has a blog section where users can read about various topics.

5. Hindi ko maintindihan kung bakit may mga taong ganito mag-isip.

6. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

7. I have been working on this project for a week.

8. Kucing adalah salah satu hewan peliharaan yang populer di Indonesia.

9. Les employeurs recherchent des travailleurs fiables et ponctuels.

10. La alimentación equilibrada y una buena hidratación pueden favorecer la cicatrización de las heridas.

11. La paciencia es necesaria para tomar decisiones importantes.

12. "Manalig ka sa Diyos at hindi ka mapapahamak," ani ng pari sa kanyang sermon.

13. Ipagtimpla mo ng kape ang bisita.

14. Sa ganang iyo, dapat bang manatili sa kanilang posisyon ang mga opisyal na hindi epektibo?

15. Hindi nya masikmura ang harap-harapang panloloko ni mayor sa kanyang nasasakupan.

16. Cryptocurrency is a digital or virtual currency that uses cryptography to secure and verify transactions.

17. Where there's smoke, there's fire.

18. Therefore, we should all steer clear of this bad habit of smoking cigarettes

19. Climbing to the top of a mountain can create a sense of euphoria and achievement.

20. El invierno es una de las cuatro estaciones del año.

21. Pantai Kuta di Bali adalah salah satu pantai terkenal di dunia yang menawarkan pemandangan matahari terbenam yang indah.

22. The United States is a leader in technology and innovation, with Silicon Valley being a hub for tech companies.

23. Nagdadasal ang mga residente para sa ulan upang matapos na ang tagtuyot.

24. Nicole Kidman is an Academy Award-winning actress known for her performances in movies such as "Moulin Rouge!" and "The Hours."

25. Kailangang salatin mo ang tela para malaman kung gaano ito kalambot.

26. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

27. The surface of the hockey rink is made of ice, which can be slippery and challenging to navigate.

28. When it comes to politics, it can be tempting to bury your head in the sand and ignore what's going on - after all, ignorance is bliss.

29. Nagluluto si Tess ng spaghetti.

30. Stop beating around the bush and tell me what's really going on.

31. Ang poot ay isang emosyon na dapat kong matutunan na kontrolin at harapin nang maayos.

32. Sa bawat salaysay ng nakaligtas, maririnig ang kanilang hinagpis sa trahedya.

33. Binantaan ng mga sibilyan ang magnanakaw bago ito tumakas.

34. Les travailleurs peuvent travailler dans une variété de domaines tels que la finance, la technologie, l'éducation, etc.

35. She admires the beauty of nature and spends time exploring the outdoors.

36. Nais niyang mag-iwan ng sulat para sa kanyang mahal.

37. Gaano kalaki ho ang gusto niyo?

38. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

39. The Statue of Liberty in New York is an iconic wonder symbolizing freedom and democracy.

40. At pagkauwiy humiga nang humiga at paulit-ulit na tumingin sa kawalan.

41. Maaga kaming nakarating sa aming pupuntahan.

42. Nakakatakot ang paniki sa gabi.

43. Gracias por hacerme sonreír.

44. She spends hours scrolling through TikTok, watching funny videos and dance routines.

45. Mi sueño es convertirme en un músico famoso. (My dream is to become a famous musician.)

46. They travel to different countries for vacation.

47. Nationalism can also lead to authoritarianism and repression of dissent.

48. Oh.. hindi ko alam ang sasabihin ko.

49. The team's performance was absolutely outstanding.

50. Seperti makan buah simalakama.

Recent Searches

fourhapdibroadcastingmulingcommercekahaponmapahamakpakakatandaani-rechargeprodujointensidadmasasayakalaunanfestivaleskinatatalungkuangpinagsikapanvirksomheder,magsalitamaluwagpisaraherramientasmalalakipakistanpakiramdamemocionesnapahintoalikabukinnagtrabahopinakamatabanglumiwanagnakatuwaangnapatawagnagtalagamakuhangpagkagustotatlumpungnapasigawbiologiuniversitynalugodcompaniesnagbagohumalotaga-ochandonamumulabayaningnapalabahinbibilieleksyontmicabumagsakestatemonumentopatiencestreetkatulongpulitikoanghelcubiclesalbaheracialpakisabiathenadesarrollarlayawallowskaarawananihinnuhmatapangkalongsineinangbutchmalihisibinalitanghumblelookedhugisyatamahahabakatedralhiningisentencemorenaleadingmansanasdoktorbatokomgsinapakcompostelaabrileliteparagraphsahitmallmightsystematiskdagaanimopatungowellcigarettesbuwalgalitheyreservedknowslaylaydelemabutingluisplayedtripcleanpapuntadecisionsstudentseyehardbumabaomfattendepaslitbiniliuniquemultofrogsofaformaapollocomodingdingmabaitmethodsaddingmenuseparationclienteputingbagkus,gayunpamandealalituntuninmisanaglinispowerdoonbasketboltagaytaymabatongnabasamuchassapagkatnageespadahandadalhinpagpalitnag-alalalunashelenamatutuwaindependentlytibokkendiipagmalaakikainipinamilipropensolorinasiramalakingcontentbahagipulang-pulapagkakamalimagkaibanakakagalaeskwelahannakakagalingmakikiraannapapalibutanpagkamanghaeskuwelahannangagsipagkantahannakagalawpagsasalitaenfermedades,kasalukuyancomputerhuertonahantadbefolkningen,inasikasoinilalabasnakayukomanggagalingnagkwentolabing-siyampagkabuhay