Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "concerns"

1. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

2. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

3. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

4. Despite the many advancements in television technology, there are also concerns about the effects of television on society

5. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

6. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

7. However, there are also concerns about the impact of technology on society

8. However, there are also concerns about the impact of the telephone on society

9. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

10. Musk has been vocal about his concerns over the potential dangers of artificial intelligence.

11. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

12. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

13. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

14. They may draft and introduce bills or resolutions to address specific concerns or promote change.

15. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

16. TikTok has been banned in some countries over concerns about national security and censorship.

17. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. Nakakabawas ng pagkatao ang mga taong laging nagmamangiyak-ngiyak dahil ito ay nagpapakita ng kahinaan sa kanilang karakter.

2. Mag-iikasiyam na nang dumating siya sa pamilihan.

3. It may dull our imagination and intelligence.

4. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

5. Ang kundiman ay isang tradisyunal na awit ng pag-ibig sa Pilipinas.

6. Kailangan kong hiramin ang iyong pliers para sa aking proyektong DIY.

7. May problema ka sa oras? Kung gayon, subukan mong gumawa ng iskedyul.

8. Walang ka kwenta-kwenta ang palabas sa telebisyon.

9. Ang mga bayani ay mga taong nagsakripisyo para sa kalayaan at kabutihan ng bayan.

10. Magkita na lang po tayo bukas.

11. Las comidas calientes y reconfortantes, como sopas y guisos, son populares en invierno.

12. Emphasis is often used in advertising and marketing to draw attention to products or services.

13. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

14. Fleksibilitetstræning, såsom yoga og strækning, kan hjælpe med at forbedre bevægeligheden og reducere risikoen for skader.

15. Pinagsabihan siya ng guro dahil napansin ang kanyang pagiging maramot sa mga kaklase.

16. The website's search function is very effective, making it easy to find the information you need.

17. Binabaan nanaman ako ng telepono!

18. Hinahayaan kong lumabas ang aking poot upang maipahayag ang aking saloobin at damdamin.

19. Hinugot niya ang kanyang cellphone upang mag-reply sa aking mensahe.

20. The early bird catches the worm.

21. A picture is worth 1000 words

22. Es importante cosechar las zanahorias antes de que se pongan demasiado grandes.

23. Para lang ihanda yung sarili ko.

24. Habang kaming mga naiwan ay paglalabanan at pag-aaralang tanggapin ang kirot ng pagkalungkot.

25. El arte abstracto tiene una simplicidad sublime que pocos pueden entender.

26. Las drogas pueden alterar el estado de ánimo y la percepción de la realidad.

27. Nagagalit ako sa mga sakim na mga minahan.

28. Pero pag harap ko, para akong nanigas sa kinatatayuan ko.

29. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

30. La música clásica es una forma de música que ha existido durante siglos.

31. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

32. Aku merindukanmu, sayang. (I miss you, dear.)

33. Tulala siyang tumitig sa malawak na tanawin ng dagat.

34. Anong oras mo gustong umalis ng bahay?

35. Ang mga guro ng musika nagsisilbi upang maipakita ang ganda ng musika sa kanilang mga estudyante.

36. Nakatulog ako sa harap ng telebisyon at nagitla ako nang biglang nagtaas ang boses ng mga artista sa palabas.

37. At blive kvinde kan også være en tid med forvirring og usikkerhed.

38. She does not skip her exercise routine.

39. Kinuha ko yung CP niya sa bedside table.

40. Dwyane Wade was a key player in the Miami Heat's championship runs and known for his clutch performances.

41. Sa gitna ng gulo, pinili niyang mag-iwan ng mga taong hindi naaayon sa kanyang pangarap.

42. Sa mga lugar na madalas tamaan ng buhawi, ang mga pamahalaan at mga organisasyon ay kailangang magkaroon ng mga programa para sa risk reduction at disaster preparedness.

43. Sa Calamba, Laguna ipinanganak ang pambansang bayani na si Jose Rizal.

44. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

45. Ang pag-uusap namin ng aking kasintahan ay nagpawi ng aming hindi pagkakaunawaan at nagbigay-daan sa pagkakasunduan.

46. Ang sugal ay isang pampalipas-oras na aktibidad na may kaakibat na panganib ng pagkakabigong pinansyal.

47. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

48. Pinagpalaluan ng mga empleyado ang kanilang manager dahil sa kanyang mahusay na pamumuno.

49. Bilang paglilinaw, ang parangal ay ibibigay sa buong grupo, hindi lamang sa isang tao.

50. Ang mga mamamahayag ay nagsusulat ng mga balita para sa pampublikong impormasyon.

Recent Searches

concernscuandopopulationsalu-salomatagpuanpilipinohaftapatkongbuwalmarahanpepealbularyopalaisipanmatagumpaybumibitiwistasyonnagpapakainnapakahusaypagamutannaglabadingtiniklingpagbibirobanlagkabuhayanebidensyavideossiopaoedit:kunginisiphawlanabanggabotetechnologicalmaasimmagpapakabaiteffectskantomaglabafertilizerchadcertainbabaparurusahancelularesluhapinigilanrichtinataluntonyumanigumiiyakmirabehalfmalezagayunpamanemocionantetumatawapapayakapamilyanagtataastinahakenglishsumalakaygawaingyumabangitinaaspagbigyanpaaniyoumabotlumipadtotoomagigitingmag-ingatabonomagawangdumikitmagulayawparusahantransmitidaspanatilihindiyosdrayberreservationhotelituturoprocessdoeswestpoloipagamotnatingalabaryodownsersikowastekablancalciumpagbahing1980ochandogracenoobopolsanamapnakangitinandayamagasawangmagsusunuranpamburapostpagtangispulgadaerlindamagbalikdisfrutararbejdsstyrkenapakagandapagbabayadberegningerkahongkamandaglumiitpaglingoneksaytedgawanapilingmagbabalasaktanpressexperts,creationmag-inamamuhaykumakapitcramemasasabiconnectingpinakamasayareadingsparerawilogdaandamitcandidatepang-araw-arawganitokilalang-kilalatelefonpatingniyangnapapatingintiniradornagbanggaangumagalaw-galawnakakamitnangangalitisulatnahuhumalingmagagamitkuwentoasignaturapagsagotutilizanpesossamahantherapeuticssapatosmaghahabihomeworknaaalalabubongjamesartistagotmalamigmahusaynavigationidiomalupaininstitucionesmanonoodtusindvisfonoslazadamaalwangandoyproblemabinigayburgerpagpapautangsinimulanamerikaflavioaffect