Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "concerns"

1. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

2. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

3. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

4. Despite the many advancements in television technology, there are also concerns about the effects of television on society

5. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

6. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

7. However, there are also concerns about the impact of technology on society

8. However, there are also concerns about the impact of the telephone on society

9. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

10. Musk has been vocal about his concerns over the potential dangers of artificial intelligence.

11. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

12. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

13. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

14. They may draft and introduce bills or resolutions to address specific concerns or promote change.

15. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

16. TikTok has been banned in some countries over concerns about national security and censorship.

17. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. Promote your book: Once your book is published, it's important to promote it to potential readers

2. Bumili ako ng prutas sa Berkeley Bowl.

3. My boyfriend took me out to dinner for my birthday.

4. Omelettes are a popular choice for those following a low-carb or high-protein diet.

5. Hindi niya naiilagan ang dagok ni Ogor.

6. The first microscope was invented in the late 16th century by Dutch scientist Antonie van Leeuwenhoek.

7. I finally finished my degree at age 40 - better late than never!

8. Halos de-lata na lang ang lagi nitong inuulam.

9. Hindi ko naabutan ang dakong huli ng pagbubukas ng tindahan.

10. Mommy. ani Maico habang humihingal pa.

11. La tos puede ser un síntoma de cáncer de pulmón.

12. La agricultura es una actividad fundamental en muchas regiones del mundo.

13. Bawal kang mapagod.. papagalitan nila ako pag napagod ka..

14.

15. Ewan ko sayo, ikaw pinakamaarteng lalakeng nakilala ko.

16. Larry Bird was a versatile forward and one of the best shooters in NBA history.

17. Lumitaw umano ang isang nawawalang antigong larawan sa isang auction sa ibang bansa.

18. Ang pagiging aware at vigilant sa paligid ay mahalaga upang maiwasan ang pagkalat ng droga sa lipunan.

19. Sí, claro, puedo prestarte algo de dinero si lo necesitas.

20. Ang pagtanggap ng mga bisita at pagkakaroon ng masayang kasiyahan ay bahagi ng mga tradisyonal na okasyon sa Chinese New Year.

21. Sa kasal, ang pagdadala ng mga panulat ay mahalaga upang masigurong makapagsulat ng matatalinong mensahe sa guest book.

22. Up above the world so high

23. Sana ay makapasa ako sa board exam.

24. Ano ang pinabili niya sa nanay niya?

25. Hindi mapigilan ang panaghoy ng binata nang mabasa ang liham ng kanyang mahal.

26. En invierno, muchas personas disfrutan de deportes como el esquí y el snowboard.

27. Natakot ang batang higante.

28. Matagal ko na syang kaibigan sa Facebook.

29. Martin Van Buren, the eighth president of the United States, served from 1837 to 1841 and was the first president to be born a U.S. citizen.

30. Aalis siya sa makalawa ng umaga.

31. Ang pagtanggi sa mga ebidensya ay nagpapakita ng pagiging bulag sa katotohanan.

32. Sa hirap ng sitwasyon, nangahas siyang humingi ng tulong mula sa mga estranghero.

33. L'éducation est un élément clé pour le développement personnel et professionnel.

34. At minamadali kong himayin itong bulak.

35. Oo naman. I dont want to disappoint them.

36. Saan siya kumakain ng tanghalian?

37. Emphasis is often used to highlight important information or ideas.

38. Alors que certaines personnes peuvent gagner de l'argent en jouant, c'est un investissement risqué et ne peut pas être considéré comme une source de revenu fiable.

39. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

40. Nakisakay ako kay Jose papunta sa airport.

41. Hindi ko maintindihan kung bakit niya nangahas na kunin ang bagay na hindi sa kanya.

42. Ano ang gagawin ni Trina sa Disyembre?

43. Kung maramot ka sa pagbigay ng tulong, huwag magtaka kung walang tutulong sa'yo.

44. Ang malakas na pagsabog ng bulkan ay binulabog ang buong komunidad.

45. Natawa si Aling Marta at pagkaraan ay dumukot sa bulsa ng kanyang bestido upang magbayad.

46. The scientific consensus is that vaccines are safe and effective in preventing the spread of disease.

47. It can create a sense of urgency to conceive and can lead to conversations and decision-making around fertility, adoption, or other means of becoming parents.

48. No puedo imaginar mi vida sin mis amigos, son una parte muy importante de ella.

49. If you think I'm the one who stole your phone, you're barking up the wrong tree.

50. Ano ang natanggap ni Tonette?

Recent Searches

paakyatconcernsredespumikittalinowowtransportationchesssiopaoskills,so-calledtumamischeckskamalianroquefeedback,makuhanyakaibigansecarseharinagagamitmakeso-onlinementalhalikapakakatandaannakakaanimmakipagkaibiganareapaglakiinintaythoughtskararatingawitpusanatabunangumapangskyspiritualnahintakutanmayaupangpinag-aralantinangkazoommisteryomerchandisedipangprincipalesmalabolabisbinabaratathenaentryayudameetnaroonbuhawisusulitpadalasgaanoprodujokikitabalitayouthbangkangfilmsyumaopagtawakamandagmangangahoypamburanegosyanteriyankagandahanerlindabrancher,pagkabiglainiresetaawabumilikantolikodellamatangumpaylondondisenyongkwartonakakatawakamiassayabalancesdumilathastanapuyatcasesanilatulangcalidadhoytangankaaya-ayanghetomaghintaytila18thmalapadbillrealisticnangapatdanpaglingontrendragonmahalagakangkumaliwainiisipinteriorlookednagagalitadicionalesdaratingipanlinis4thpagbabayadmagbaliknagkasakitpantalonghusonaglalakadmaisipinilalabasstudiedinfluentialmagtatanimnagsasagotpayongawareunconstitutionalflyinuminpleasecreditwalanglihimamazonnapapalibutanbigotedisfrutarpagkakamalibubongtungobedsidemasdanuntimelyandroidgeneratedroboticrestnakaliliyongwebsitepublishedbitawanlenguajelumakascharismaticlabassequemarielstatemapalampaskanasadyanghitaskirtpiyanonagpakitafeelcameranaghilamosnagkapilatmagawacultivonatitiyakknownbumagsaktshirtbakacasamaubosuugod-ugodnagmakahingiroughlaruinfatnakikini-kinitamakapangyarihancountries