Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "concerns"

1. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

2. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

3. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

4. Despite the many advancements in television technology, there are also concerns about the effects of television on society

5. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

6. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

7. However, there are also concerns about the impact of technology on society

8. However, there are also concerns about the impact of the telephone on society

9. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

10. Musk has been vocal about his concerns over the potential dangers of artificial intelligence.

11. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

12. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

13. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

14. They may draft and introduce bills or resolutions to address specific concerns or promote change.

15. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

16. TikTok has been banned in some countries over concerns about national security and censorship.

17. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1.

2. Siya ay nangahas na magsabi ng katotohanan kahit alam niyang maaari siyang mapahamak.

3. Nagtitinda ang tindera ng mga prutas.

4. Muchas serpientes venenosas poseen colmillos huecos a través de los cuales inyectan veneno en sus presas.

5. Sa bahay ni Pina ang salu-salo.

6. Sampai jumpa nanti. - See you later.

7. Nakipagtagisan sya ng talino sa kapwa estudyante.

8. Sumama ka sa akin!

9. Para aliviar un resfriado, puedes hacer una infusión de hierbas como el eucalipto y la manzanilla.

10. If you think I'm the one who stole your phone, you're barking up the wrong tree.

11. The project was behind schedule, and therefore extra resources were allocated.

12. Tumawag ang pamilya ng albularyo upang gumaling ang kanilang kamag-anak mula sa misteryosong sakit.

13. I love you so much.

14. El invierno es una de las cuatro estaciones del año.

15. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

16. This has led to a rise in remote work and a shift towards a more flexible, digital economy

17. I have a Beautiful British knight in shining skirt.

18. The king's court is the official gathering place for his advisors and high-ranking officials.

19. Hanap-buhay niya ang himayin ang mga buto mula sa bulak at gawing sinulid ang bulak.

20. Bumili si Ryan ng pantalon sa palengke.

21. Walang ka kwenta-kwenta ang palabas sa telebisyon.

22. Pumunta ako sa Laguna noong Sabado.

23. Nakita ko namang natawa yung tindera.

24. Ang bawat isa ay may bahagi sa pagpapabuti ng bayan.

25. Menjaga kesehatan fisik dan mental juga berperan penting dalam mencapai kebahagiaan yang berkelanjutan.

26. Maraming tao ang naniniwala sa kakayahan ng albularyo kahit hindi ito lisensyado.

27. Sa Manila Hotel ka titigil, hindi ba?

28. Ang itim mo, Impen! itutukso nito.

29. He has been practicing basketball for hours.

30. Saka sila naghandang muli upang ipagtanggol ang kanilang bayan.

31. Sa gitna ng katahimikan ng gabi, narinig ang panaghoy ng isang inang nawalan ng anak.

32. Los sueños son una forma de imaginar lo que podemos ser y hacer en la vida. (Dreams are a way of imagining what we can be and do in life.)

33. Kilala si Hidilyn Diaz sa kanyang malakas na paninindigan para sa mga kababaihan at atletang Pilipino.

34. Huwag kang maniwala dyan.

35. Masayang-masaya ako ngayon dahil nakapasa ako sa board exam.

36. If you think he'll agree to your proposal, you're barking up the wrong tree.

37. Wag na sabi, wag kang magsayang ng gas maraming nagugutom!

38. Katamtaman ang pangangatawan ng nanay ko.

39. Sa probinsya, maraming tao ang naglalaba sa ilog o sa bukal.

40. Einstein was offered the presidency of Israel in 1952, but declined the offer.

41. Ang daming labahin ni Maria.

42. Les frais d'hospitalisation peuvent varier en fonction des traitements nécessaires.

43. Hindi ko alam kung pano ito sasabihin, hindi na ako magpapaligoyligoy pa, si Helena ay wala na.

44. Napakalakas ng bagyong tumama sa kanilang bayan.

45. Después de la tormenta, el cielo se vuelve más oscuro y las nubes se alejan.

46. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

47. Einstein was awarded the Nobel Prize in Physics in 1921 for his explanation of the photoelectric effect.

48. Ang buhawi ay maaaring magdulot ng matinding pagkasira sa kagubatan at kapaligiran dahil sa malakas na hangin at pag-ulan.

49. Le tabagisme est un facteur de risque majeur pour de nombreuses maladies, notamment les maladies cardiaques et le cancer.

50. Kumain siya at umalis sa bahay.

Recent Searches

consideredconcernslutuinandyneversambitipinalutothreepaceferrerconectantruechefconstitutionmarkedeachtiniklingweddingtutoringspreadalammarchsakalingganidcontent:daddykriskaabimalamangnatutulogincidenceearlynaubos19291970shuliutak-biyanaglalatangmagkakaroonnewspapersmakisigmakapangyarihangpapanhiklumiwanagopgaver,nakatirafotostumawagkapangyarihangnakaka-inmagpaliwanagkagandahagmagkaibiganpaki-translatecassandranag-aalanganbarung-barongikinasasabiknagbakasyonmagtatagalpagkalungkotadvertising,tinutopparehongmagtataasmumuntingpinakidalanaliwanaganmagsi-skiingdiscipliner,kapasyahanbusinessesnaiyakliv,balediktoryannai-dialmaanghangjejumauupohayaangsinusuklalyanpagtatanimprodujoinilistapamasahehumalomagpagupitmalulungkotpiyanobinge-watchingteknologinabiawangtinatanongkainitanganapinsakyankilayautomatisknakainomtuktoktutusinmagsisimulakuripotbusytawasumimangotlasajennykunehorolandmadalingrememberedmanilanandiyankulisapumibigtanawaregladodiseasesadvertisinghuertohinukaypalitanpayapangandreadyosagawanaglulusakginoongumisiptirangakmangairplanespangingimimatagumpayaminmarangyangcolorpeppyskyldespagputiinatake1950swasaklaruaniigibmalapitanmagnifysilyadangerousreguleringbansanginomtshirthumblebingbingchoiinantaybumabahaasthmaibinalitangdalagangmagtipidritwalasulinilalabasmaisadverseipinadalaelitecentermagdalayascontent,grinssuccessfulbitiwanlandomakaratingmaduraspulahumanosumalibeintespendingsumasaliw1973bilismightpakelamlasingerobienpageotrasbuwalhabangbulsaexpectationssutilinterpreting